KEGG   Gluconacetobacter diazotrophicus PA1 5 (Brazil): GDI0196Help
Entry
GDI0196           CDS       T00631                                 

Gene name
gatA
Definition
(GenBank) putative glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
gdi  Gluconacetobacter diazotrophicus PA1 5 (Brazil)
Pathway
gdi00970  Aminoacyl-tRNA biosynthesis
gdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GDI0196 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gdi03029]
    GDI0196 (gatA)
Enzymes [BR:gdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GDI0196 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GDI0196 (gatA)
Mitochondrial biogenesis [BR:gdi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GDI0196 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase PsaL Toprim_3
Motif
Other DBs
NCBI-ProteinID: CAP54139
RhizoBase: GDI0196
UniProt: A9H2D6
Position
210069..211487
Genome map
AA seq 472 aa AA seqDB search
MTARDLADLSLVDAVDAVAMRETTSMALLEACLARLDAAEERINATIWLDREGAFRAAEA
ADKAVAAGAALGLLHGLPLAHKDMYYQAGRPCTCGSVIRKDFVPTVTATVVERMAAAGAY
AYGGLNMAEFAMNPTGHNAHYGDCHNPWNLPYITGGSSSGSGAAVASRCTYGALGSDTGG
SIRLPAAACGVTGLKPTQTRVSRAGVMPLSFSADNVGPLTRTVRDCARMMKVIAGQDSRD
PTSSAEPVPDYEAALDGDLRGLRVGIPTTYFLDGADAPVVAAFEAAVAVLAGRGATVMRL
PLPLMDAVSVYAGVLLRVEAAAIHAEWMRERPQDYSVQLSARLFGGNAIPAPYYVEALSR
RGPILKAFADEVFGQVDVLATPTIRTCLPTLAETNIDQGSPASVQAFMAVSANTRPFNYL
GLPAISVNCGFDPNGCPIGLQIAGRPFAEARVMTVADAYQRDTDWHTRQPPL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcgggatctggccgatctgagccttgtggatgcggtggacgcggtcgctatg
cgcgagacgacctccatggcgcttctggaggcctgtctggcccggcttgacgccgccgag
gagcggatcaacgccaccatctggctcgatcgggagggggctttccgcgcggcggaggcc
gccgacaaggccgtggccgcgggcgctgcgctggggctgctgcacggcctgccgctggcg
cacaaggacatgtactatcaggccggcaggccgtgcacctgcggatcggtgatccgcaag
gatttcgtccccacggtgacggcgaccgtggtcgagcgcatggccgcggccggggcctat
gcctatggcggcctgaacatggccgaattcgcaatgaacccgacgggtcacaacgcgcat
tacggcgactgtcataacccctggaaccttccctatatcaccggtggctcgtccagcgga
tcgggggcggcggtcgcctcgcgctgcacctatggcgcgttggggtccgatacgggtggt
tccatccgtctgccggcggctgcctgtggcgtgacgggcctgaagccgacacagacgcgg
gtcagccgcgcgggggtgatgccgctttccttttcggcggacaatgtgggccccctgacg
cgcacggtgcgggattgtgcccgcatgatgaaggtcatcgccgggcaggacagccgcgac
ccgaccagttccgccgagcccgtaccggattatgaggccgccctggacggcgatctgcgg
ggcctgcgggtcggcattccgaccacttattttctggatggcgccgatgctccggttgtc
gccgcattcgaggccgcggtagctgtcctggccggacgcggcgcaaccgtaatgcggctg
ccgctgccgctgatggatgcggtttccgtctatgccggtgttctcctccgtgtcgaagcc
gcggcgatccatgccgaatggatgcgcgagcgcccccaggactattccgtacagctcagc
gcgcggctgtttggcggcaatgccattcccgctccttattacgtggaggcgttgagccgg
cgcggcccgatcctcaaggccttcgcggatgaggtcttcgggcaggtcgatgtcctggcg
acgcccacgatccgcacctgcctgccgaccctggccgagaccaatatcgaccaggggtcg
cccgcttccgtgcaggcgttcatggccgtgtccgcgaatacgcgaccgttcaactatctg
ggcctgccggcaatcagcgtgaattgcggtttcgacccgaacggttgccccatcggcctg
cagatcgccggccgaccgttcgccgaggcgcgcgtgatgacggttgccgatgcctaccag
cgcgacacggactggcacaccagacagccgcctctctga

DBGET integrated database retrieval system