KEGG   Gluconacetobacter diazotrophicus PA1 5 (Brazil): GDI1777Help
Entry
GDI1777           CDS       T00631                                 

Gene name
glmU
Definition
(GenBank) putative Bifunctional protein glmU [Includes: UDP-N-acetylglucosamin pyrophosphorylase (EC 2.7.7.23) (N-acetylglucosamine-1-phosphat uridyltransferase); Glucosamine-1-phosphate N-acetyltransferas (EC 2.3.1.157)]
  KO
K04042  bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC:2.7.7.23 2.3.1.157]
Organism
gdi  Gluconacetobacter diazotrophicus PA1 5 (Brazil)
Pathway
gdi00520  Amino sugar and nucleotide sugar metabolism
gdi01100  Metabolic pathways
gdi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GDI1777 (glmU)
Enzymes [BR:gdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.157  glucosamine-1-phosphate N-acetyltransferase
     GDI1777 (glmU)
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     GDI1777 (glmU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep NTP_transf_3 NTP_transferase IspD Hexapep_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CAP55720
RhizoBase: GDI1777
UniProt: A9HI46
Position
1806268..1807653
Genome map
AA seq 461 aa AA seqDB search
MNATVPSAAPADLPAHRPATAVILAAGMGTRMKSDRPKVMHPLAGQPMLRYLLDNAASVF
DRIVVVVGPGMEQVAALAAPHAVVVQQDRLGTAHAAAQAADLFGTGDVAVLYGDNPLITA
DSMRRMLACRAGEGNSEGAGLALMAMRPRDPGRYGRVVTQDGLVRRIVEWADASDEERAI
TLCNAGVLCAGAEDFRRWLGAVRNDNAQGEYYLGDVVAMAVAEGRQVRAVEAPEDELRGI
NSRAELAEAEACVQRRLRAAALDGGATLVAPETVFLAADTVLEPDVLVQPHVVFGPGVTV
RRGAEIRAFSHLEGCVVGPGALIGPYARLRPGSDVGAAAHVGNFVELKATTLGAGAKANH
LSYLGDATIGPATNIGAGTITCNYDGVFKHRTDIGAGCFVGSNAILVAPVSIGDGALVAA
GSVITQDVLPDAMALGRARQTNKDGRGASLQAALRRKKEQG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaccgtcccgtccgcggcgcccgctgacctgcccgcccatcgtcccgccacc
gccgtcatcctggcggccgggatggggacgcgcatgaagtccgatcgtccgaaggtgatg
cacccgctggccgggcagccgatgctgcgctacctgctggacaatgccgcctcggtcttc
gaccggatcgtcgtcgtggtcgggccgggcatggagcaggtcgccgccctggccgcgccg
cacgccgtcgtggtgcagcaggacaggctgggcaccgcccacgcggcggcccaggccgcg
gacctgttcgggaccggcgatgtcgcggtcctgtatggcgacaacccgctgatcacggcg
gacagcatgcgccgcatgctggcgtgccgggcgggcgaggggaacagcgagggggcgggc
ctggccctgatggccatgcggccgcgcgatcccggacgctatggccgcgtggtgacgcag
gacgggctggtccggcgcatcgtcgaatgggctgacgcgtcggacgaggagcgggcgatc
accctgtgcaatgccggcgtgctgtgcgcgggggcggaggatttccgccgctggctgggt
gccgtgcgcaacgataacgcccagggcgagtattatctgggcgacgtggtggccatggcg
gtggccgaaggacggcaggtccgtgccgtcgaagcacccgaggacgagttgcgcggcatc
aattcccgtgccgaactggccgaggccgaagcctgcgtgcagcgccggctgcgcgccgcg
gcgctggatggcggggcgacgctggtggcgcccgaaacggtgttcctggccgccgacacg
gtgctggaacccgacgttctggtccagccccatgtcgtcttcgggccgggcgtgacggtg
cggcggggggcggaaatccgcgccttcagtcatctggaaggctgcgtggtcgggccgggg
gcgctgatcggcccctatgcgcggctgcggccgggcagcgatgtcggggccgccgcccat
gtcggcaatttcgtcgaactgaaggccacgaccctgggggcgggggcgaaggccaatcac
ctgtcctatctgggcgatgcgacgatcggcccggcgacgaatatcggcgcgggcacgatc
acgtgcaattatgacggggtgttcaagcaccggacggacatcggcgcgggatgcttcgtg
ggatcgaacgcgattctggtcgcccccgtcagcatcggcgacggcgcgctggttgccgcc
ggcagcgtcatcacccaggacgtgctgcccgacgccatggcgctgggccgggcccggcag
acgaacaaggacggacgcggggccagcttgcaggcggcgctgcgcaggaagaaggaacag
ggctga

DBGET integrated database retrieval system