KEGG   Gluconacetobacter diazotrophicus PA1 5 (Brazil): GDI2255
Entry
GDI2255           CDS       T00631                                 

Gene name
purA
Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
gdi  Gluconacetobacter diazotrophicus PA1 5 (Brazil)
Pathway
gdi00230  Purine metabolism
gdi00250  Alanine, aspartate and glutamate metabolism
gdi01100  Metabolic pathways
Module
gdi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:gdi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GDI2255 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GDI2255 (purA)
Enzymes [BR:gdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     GDI2255 (purA)
SSDB
Motif
Pfam: Adenylsucc_synt
Other DBs
NCBI-ProteinID: CAP56198
RhizoBase: GDI2255
UniProt: A9HLQ1
Position
complement(2312065..2313354)
AA seq 429 aa
MSNVTVIGAQWGDEGKGKIVDWLASRADIVVRFQGGHNAGHTLVVGSQTYKLSLLPSGLV
RGKMGVIGNGVVVDPEALLAEIDRVSAQGLEVSPRTLRIAENVPLILPVHGAIDRAREAA
RGDRKIGTTGRGIGPAYEDKVARRAIRLCDLAEPETLDWKLDELLLHHNTLLAGLGAETF
TKDALLAHLTALAPRVLPYMDTVWDLLDDARRAGRRILFEGAQAVMLDVDHGTYPFVTSS
NTIAANAATGSGVGPGSVGFVLGIAKAYSTRVGEGPFPSELHDDMGRTLGERGHEFGTVT
GRPRRCGWFDAMLVRRAVRVGGVNGLALTKLDVLDGLPEIRVCVGYELDGQEIRSFPSSP
AAQARVKPIYETMEGWTDTTYGARSWADLPAQAIKYVRRIEELVEAPVTLLSTSPERDDT
ILMRDPFEN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgtccaacgtcaccgtcatcggcgcccagtggggtgacgagggaaagggcaagatcgtc
gactggctggccagccgcgccgatatcgtcgtccgcttccagggcggtcacaatgccggc
catacgctggtggtgggcagccagacctacaagctgtcgctgctgccgtccggcctggtc
cgaggcaagatgggggtgatcggcaacggcgtcgtcgtggaccccgaggcgctgctggcg
gaaatcgaccgggtgagcgcgcaggggctggaagtatcgccgcggacgctgcgcatcgct
gaaaacgtgccgctgatcctgcccgtccacggcgccatcgatcgcgcgcgtgaagccgcg
cgcggcgaccgcaagatcggcaccacgggccgcggcatcggcccggcctacgaggacaag
gtggcacgccgcgccatccgcctgtgcgacctggccgagcccgagacgctggactggaag
ctggacgaactgctgctgcaccacaacacgctgctggccggcctgggggccgagaccttt
accaaggacgccctgctggcccacctgaccgcgctggcgccgcgcgtgctgccctacatg
gatacggtgtgggacctgctggacgatgcgcgccgcgccggacggcgaatcctgttcgaa
ggtgcgcaggcggtgatgctggacgtcgatcacggcacctatccgttcgtcaccagttcc
aacaccatcgcggccaatgccgcgaccggcagcggcgtggggccgggcagcgtcggcttc
gtgctgggtatcgccaaggcctattcgacccgcgtgggcgaggggccgttccccagcgaa
ctgcatgacgacatgggccgcaccctgggcgagcgcgggcatgaattcggcacggtgacg
gggcgcccccgccgctgcggctggttcgacgccatgctggtccgccgcgcggtgcgcgtg
ggcggcgtcaacggtctggccctgaccaagctggacgtgctggatggcctgcccgagatc
cgcgtgtgcgtcggctatgaactggacggccaggaaatccgcagcttcccgtcctcgccg
gcggcgcaggcccgcgtcaagccgatctacgagacgatggaaggctggaccgataccacc
tacggcgcgcggtcctgggcggacctgccggcgcaggcgatcaaatatgtccgccggatc
gaggaactggtcgaggcaccggtgaccctgctgtccaccagtccggaacgcgacgatacg
atcctgatgcgcgacccgttcgagaactga

DBGET integrated database retrieval system