KEGG   Gluconacetobacter diazotrophicus PA1 5 (Brazil): GDI2815Help
Entry
GDI2815           CDS       T00631                                 

Gene name
recD
Definition
(GenBank) putative exodeoxyribonuclease
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gdi  Gluconacetobacter diazotrophicus PA1 5 (Brazil)
Pathway
gdi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gdi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    GDI2815 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gdi03400]
    GDI2815 (recD)
Enzymes [BR:gdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GDI2815 (recD)
DNA repair and recombination proteins [BR:gdi03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     GDI2815 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 SH3_13 UvrD_C_2 HHH_5 Viral_helicase1 Helicase_RecD HHH_2 PIF1 AAA_11 MeaB NTPase_1 T2SSE AAA_16 RsgA_GTPase AAA_29 ABC_tran AAA_28 IstB_IS21 ATP_bind_1 AAA_24 AAA cobW MMR_HSR1 DUF2075 AAA_22 NACHT DEAD AAA_23 UvrD-helicase ABC_ATPase TsaE MobB TrwB_AAD_bind HHH NB-ARC
Motif
Other DBs
NCBI-ProteinID: CAP56758
RhizoBase: GDI2815
UniProt: A9HQK8
Position
complement(2896416..2898602)
Genome map
AA seq 728 aa AA seqDB search
MSGRAIDSSPTEALAGLVERVTFHNAENGFCVLRVKVRGQRDLVTVVGHAAMISAGEFVQ
MSGRWFNDHTHGLQFKAEFLKASPPTTVEGIERYLGSGMIRGIGPVYAKKLVKAFGEAVF
DLIEQEPHRLREVTGIGPKRAERIVGGWADQKVIREIMLFLHSNGVGTSRAVRIFKTYGQ
DAVQLISENPYRLAKDIRGIGFKTADQIARKMGIAPDAMIRVRAGISYALGEAMEEGHCG
LPVGELLTSTAELLEVAAPLIETALALELEAGDVVADSVGDTDCIFLAGLYRAERSIAER
LRACAVGRPPWPEIDAAKAMTWVEGKTGLALAPSQQEAVRLALRSKVLVITGGPGVGKTT
LVNAILKIVTAKGTDVQLCAPTGRAAKRLSESTGLEGKTIHRLLETDPANGSFKRDDTNP
LTCDLLVVDEASMVDVLLMRSLLRALPDSAALLIVGDVDQLPSVGPGQVLADIIGSDAVP
VVRLTEVFRQAAQSRIITNAHRINEGKMPDLSAEEGSDFYFVEAAEPEAGLRKLLAVVKD
RIPARFGLDTVRDVQVLCPMNRGGLGARSLNIELQQALNPPGEVKVERFGWTYGPGDKVM
QIANDYDRDVFNGDLGVIDMIDVEEGELTVLFDGREVVYGFGELDELVLAYATTIHKSQG
SEYPAVVIPLVTQHYAMLARNLLYTGVTRGRKLVVLVGQKKALAIAVRNQGGRRRWSKLR
EWLAGSVA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacgtgccatcgactcttcgcccacggaagcgctggcgggactggtcgagcgg
gtgacgttccataatgccgagaacggcttctgcgttctgcgggtgaaggtgcggggacag
cgcgatctggtcaccgtcgtcggccatgccgccatgatctcggcaggcgagttcgtgcag
atgtcggggcgctggttcaacgaccacacccacggcctccagttcaaggccgagttttta
aaggccagcccgccgaccacggtcgagggcatcgagcgctatctgggctcaggcatgatc
cggggcatcggtccggtctacgccaagaaactggtgaaagcgttcggcgaggcggtgttc
gacctgatcgaacaggaaccgcaccgcctgcgggaggtgacgggtatcggccccaagcgt
gccgaacggattgtcggtggctgggcggaccagaaggtgatccgcgagatcatgctgttc
ctgcacagcaatggtgtcggcacctcgcgggcggtgcggatcttcaagacctacggacag
gacgcggtccaactgatcagtgagaacccctaccggctggcgaaggacattcggggtatc
gggttcaagaccgctgaccagatcgcccggaagatggggatcgcgcccgacgccatgatc
cgggtacgggccgggatttcctatgcccttggcgaggcgatggaagaggggcattgcggt
ctgccggtcggggagctgctgaccagcaccgccgaactgctggaggtcgcggcacccctg
atcgagacggcgctcgcgctggaactggaagcaggggacgtggtcgccgacagcgtgggc
gatacggactgcattttcctggctggtctctatcgcgcggagcggagcattgcggagcga
ttgcgtgcctgtgccgtgggtcgaccgccctggcccgagatcgacgctgcaaaagccatg
acctgggtcgaaggcaagactgggcttgcgctcgcgcccagccagcaggaggcggtgcgc
cttgccctgcgcagcaaggtgctggtgatcacgggggggcccggtgtcggcaagaccacg
ctggtcaacgccatcctcaagatcgtgaccgccaagggcacggacgtgcagctttgtgcg
ccgacgggccgcgcggcgaagcgcctgtcggaaagcaccggactggaaggcaagaccatc
catcgactgctggagacggatccggcgaatggcagtttcaaacgggacgacaccaacccg
ctgacctgcgatctgctggtcgtggacgaggccagcatggtggacgtgctgctgatgcgc
tccctgctgcgcgcgttgcccgacagtgcggcgctgctgatcgtgggggacgtggaccag
ttgccgtcggtcggaccggggcaggtgctggcggatatcatcggttcagatgccgtgccg
gtggtgcggctgaccgaggtgttccgccaggcggcgcagagccggattatcaccaatgcg
caccggatcaacgaagggaagatgccggatctgagcgcggaagagggatcggatttctat
ttcgtggaggcggccgagcccgaggctgggctgcgcaagttgctggccgtggtgaaggac
cgcatcccggcgcggttcgggctggacacggttcgcgacgtgcaggtgctgtgcccgatg
aaccggggcggccttggggcgcgatcgctgaatatcgaattgcagcaggcgttgaatccg
ccgggcgaggtgaaggtcgagcggttcggctggacctatggtcccggcgataaggtgatg
cagatcgccaatgattatgaccgggacgtcttcaacggggatctcggcgttatcgacatg
atcgatgtggaagagggcgaactgacggtcttattcgatggacgggaagtcgtttatggc
tttggggaactggatgaactggtgctcgcctatgccaccacgatccacaagagccaggga
tccgaatatccggccgtggtgatcccgctggtgacccaacattacgccatgctggcgcgg
aacctgctctataccggcgtcacacggggacggaagctcgtcgtgctcgtgggccagaag
aaggcgctggcaatcgctgtgcgcaatcagggcgggcggcggcggtggtcgaagctcagg
gagtggctggccggtagcgttgcatga

DBGET integrated database retrieval system