KEGG   Gluconacetobacter diazotrophicus PA1 5 (Brazil): GDI3189Help
Entry
GDI3189           CDS       T00631                                 

Gene name
murD
Definition
(GenBank) putative UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
gdi  Gluconacetobacter diazotrophicus PA1 5 (Brazil)
Pathway
gdi00471  D-Glutamine and D-glutamate metabolism
gdi00550  Peptidoglycan biosynthesis
gdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    GDI3189 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GDI3189 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gdi01011]
    GDI3189 (murD)
Enzymes [BR:gdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     GDI3189 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:gdi01011]
 Precursor biosynthesis
  Amino acid ligase
   GDI3189 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C AlaDh_PNT_C CbiA NAD_binding_2 MeaB
Motif
Other DBs
NCBI-ProteinID: CAP57132
RhizoBase: GDI3189
UniProt: A9H0I3
Position
3276360..3277757
Genome map
AA seq 465 aa AA seqDB search
MSGPGLFPPGLLAGSRYAVLGLGRNGAPAVRALAAMGADVQAWDDGDAARAAVADVPGVA
IAPFDTLAGFDALVLSPGIPHILPHPHPVARMAHAAGVPILSDANLLFQAVRRSGSRARF
AGITGTNGKSTTTTLLAHMLHTAGLPVAAGGNLGPAALALPLLPDTGVYVLEMSSYMLER
LRDLRFDAACLLNLTPDHLDRHGDMAGYRRAKQHVFDRQGPGDLAVLGQYDAPDDAALAR
DLAARGIRVVTISGTRADAGLTGAGGVLRDADGPIATLADAPSLPGAHNAENAAAAAAMA
LALGVPRATIAGALRTFPGLAHRQKPVGTVDGVRFIDDSKATNADAASRALGCYDRLVWI
AGGVAKAGGIADLAPFFPRVAHAFLIGQDAPALAETLAAHGVAFTLSGTMDAAVPAALAL
ARRDGVPVVLLSPACASFDQYASFEHRGRHFADLVRLLAPTLGTD
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcccgggcctgttcccccccggcctgttggccggcagccgctacgcggtgctg
gggctggggcgcaacggcgcccccgccgtccgcgcgctggccgcgatgggggcggacgtg
caggcctgggatgacggcgacgccgctcgtgcggcggtcgcggacgtgccgggcgtcgcc
atcgcgccgttcgacacgctggcggggttcgacgcgctggtgctctcgcccggcattccg
cacatcctgccccacccgcatcctgtcgcccggatggcgcacgcggcgggcgttcccatc
ctgtcggatgccaacctgctgttccaggcggtgcgccggtccgggtcgcgcgcgcgcttc
gccggcatcaccggaaccaacggcaaatcgaccaccaccaccctgctggcccacatgctc
cacaccgccggcctgccggtcgcggcgggcgggaacctgggcccggcggcgctggcgctg
ccgctgctgcccgacacgggcgtctatgtgctggaaatgtcgtcctacatgctggaacgg
ctgcgggacctgcgcttcgacgccgcgtgcctgctgaacctgacgcccgaccacctggac
cgccatggcgacatggcaggctatcgacgggccaagcagcacgtcttcgaccgccaggga
ccgggcgacctggccgtgctgggccagtacgacgccccggacgacgcggcgctggcccgc
gacctggcggcgcgcggcatccgggtcgtcaccatatccggcacccgtgccgacgccggc
ctgaccggcgccgggggtgtgctgcgcgacgcggacgggccgatcgccaccctggccgat
gccccatccctgcccggcgcgcacaatgccgaaaacgcggcggcggcggcggcgatggcc
ctggcgctgggcgtgccgcgcgccacgatcgccggcgcgctgcggaccttcccgggcctg
gcccaccggcagaagccggtcggcaccgtcgacggcgtgcgcttcatcgacgacagcaag
gcgacgaacgccgatgccgcatcgcgggcgctgggctgctacgaccggctggtgtggatc
gcgggcggtgtggccaaggccggcggaatcgcggacctggcgccgttcttcccgcgcgtg
gcccatgctttcctgatcgggcaggacgcgccggcgctggccgaaaccctggccgcgcac
ggcgttgccttcacgctgtcgggcacgatggacgcggcggtgcccgccgccctcgccctg
gcgcggcgggacggcgtgccggtggtgctgctgtcccccgcctgcgccagctttgatcag
tacgccagcttcgaacatcgcggccggcacttcgcggacctggtccgcctgctggcgccc
acattggggacggactga

DBGET integrated database retrieval system