KEGG   Gluconacetobacter diazotrophicus PA1 5 (Brazil): GDI3405
Entry
GDI3405           CDS       T00631                                 

Gene name
rpsJ
Definition
(GenBank) putative 30S ribosomal protein S10
  KO
K02946  small subunit ribosomal protein S10
Organism
gdi  Gluconacetobacter diazotrophicus PA1 5 (Brazil)
Pathway
gdi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gdi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GDI3405 (rpsJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gdi03011]
    GDI3405 (rpsJ)
Ribosome [BR:gdi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    GDI3405 (rpsJ)
  Bacteria
    GDI3405 (rpsJ)
  Archaea
    GDI3405 (rpsJ)
SSDB
Motif
Pfam: Ribosomal_S10
Other DBs
NCBI-ProteinID: CAP57348
RhizoBase: GDI3405
UniProt: A9H3R6
Position
complement(3499666..3499974)
AA seq 102 aa
MDNQNIRIRLKAYDHRVLDNSTKEIVNTAKRTGARVRGPIPLPTHIEKFTVNRSPHVDKK
SREQFEIRTHRRLLDIVEPTPQTVDALMKLDLAAGVDVEIKL
NT seq 309 nt   +upstreamnt  +downstreamnt
atggacaaccagaacatccgcattcgcctgaaggcgtacgatcatcgggtgctcgacaac
agcaccaaagagatcgtcaacacggcgaagcgtacgggtgcgcgggttcggggtcctatc
ccgctgccgacgcatatcgaaaaattcaccgtcaaccgctctccccatgtggacaagaaa
agccgcgagcagttcgaaattcggacccatcgccggctgctcgacattgtcgagccgacc
ccgcagaccgtggacgctctcatgaagctcgacctcgccgccggcgtggatgtcgagatc
aaactttaa

DBGET integrated database retrieval system