KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_0029Help
Entry
Gdia_0029         CDS       T00798                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00450  Selenocompound metabolism
gdj00970  Aminoacyl-tRNA biosynthesis
gdj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Gdia_0029
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Gdia_0029
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gdj01007]
    Gdia_0029
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gdj03016]
    Gdia_0029
Enzymes [BR:gdj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Gdia_0029
Amino acid related enzymes [BR:gdj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Gdia_0029
Transfer RNA biogenesis [BR:gdj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Gdia_0029
 Prokaryotic type
   Other AARSs
    Gdia_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f B12-binding
Motif
Other DBs
NCBI-ProteinID: ACI49831
UniProt: A9HIA3
Position
33122..34660
Genome map
AA seq 512 aa AA seqDB search
MTRRYYVTTPIYYVNGAPHIGHAYTSVAADIVARFKRLAGFDVFFLTGTDEHGQKVEQAA
QAAGLAPIAFADRVSADFRAMYDVMNVSYDDFIRTTEPRHIAGATALWERIAANGHIYLG
AYEGWYALRDESFYNEDELVTQPDGTRVAPTGAPVEWVREPSYFFRLSAFADRLLDLYET
RPGFVEPASRRNEVASFVRQGLRDLSISRTSFRWGIPVPGDADHVMYVWVDALANYLSAI
GFPDARNPRAGFWPANLHLVGKDIVRFHAIYWPALLMAAGLDLPDCVFSHGWWTIEGEKM
SKSLGNVVDPRDLVAEFGLDPVRFFLMREMPFGGDSDLSRKAIINRMNVELANDLGNLAQ
RTLSQVARNCGGLLPEQGTRTDDDIALLAQADLLPTLMHEQIDRRALTDALEEVWRVIRA
CNAYIDRQAPWALKKTDPDRMAVVLRVLVDALRGIGTMLQPYMPGSMDALLTQLGVAEDE
RDFASLATPLPGGRALPPPQGIFPRYVEAEAQ
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgacccggcgctattacgtcacgacaccgatctattatgtgaacggggcgccccatatc
ggccacgcctatacatcggtcgccgccgacatcgtggcgcggttcaagcggctggcgggt
ttcgacgtcttcttcctgaccggcacggacgaacacggccagaaggtggaacaggccgcc
caggcggcgggcctggccccgatcgcgttcgcggaccgcgtttcagccgatttccgcgcg
atgtacgacgtgatgaacgtctcgtacgacgatttcatccgcaccaccgaaccgcgtcac
atcgccggcgccacggccctgtgggagaggatcgcggcgaacggccatatctacctgggt
gcgtacgagggctggtacgccctgcgcgacgaaagcttctataacgaggacgaactggtt
acccagcccgacggcacccgggtcgcgccgaccggcgccccggtcgaatgggtccgcgag
ccgtcctatttcttccgcctgtccgccttcgccgaccggctgctggacctgtacgaaacc
cgcccgggcttcgtggagcccgcgtcgcggcgcaacgaggtcgcaagcttcgtccgccag
ggcctgcgcgacctgtcgatcagccgcaccagcttccgctggggcattccggtgcccggc
gatgccgatcacgtgatgtatgtctgggtcgacgcgctggccaactacctgtccgcgatc
ggctttcccgacgcccgcaacccgcgcgcgggcttctggccggcgaacctgcacctggtg
ggcaaggacatcgtccgcttccacgccatctactggccggcgctgctgatggcggcgggt
ctggacctgccggactgcgtcttctcgcacggatggtggaccatcgagggcgagaagatg
agcaagtcgctgggcaatgtcgtcgatccgcgcgacctggtggcggaattcggcctggac
ccggtgcgcttcttcctgatgcgcgaaatgcccttcggcggtgacagcgacctgagccgc
aaggccatcatcaaccggatgaatgtcgaactggccaacgacctgggcaacctggcgcag
cgcacgctgtcgcaggtggcgcgcaattgcggcgggctgctgccggagcagggcacgcgg
accgacgacgacatcgcgctgctggcgcaggccgacctgctgccgaccctgatgcacgaa
cagatcgaccgccgcgccctgaccgacgcgctggaagaggtctggcgcgtcatccgcgcc
tgcaacgcctatatcgaccgccaggccccgtgggcgctgaagaagaccgatcccgaccgg
atggcggtggtgctgcgcgtgctggtcgatgccctgcgcggcatcggcaccatgctgcag
ccctacatgcccggcagcatggatgcgctgctgacgcagcttggcgtggcggaggacgag
cgcgatttcgcgtccctggccacgccgctgccgggcggacgcgccctgccgccgccgcag
gggatctttccccgttacgtggaggccgaggcgcaatga

DBGET integrated database retrieval system