KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_0154Help
Entry
Gdia_0154         CDS       T00798                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00010  Glycolysis / Gluconeogenesis
gdj00051  Fructose and mannose metabolism
gdj00562  Inositol phosphate metabolism
gdj01100  Metabolic pathways
gdj01110  Biosynthesis of secondary metabolites
gdj01120  Microbial metabolism in diverse environments
gdj01130  Biosynthesis of antibiotics
gdj01200  Carbon metabolism
gdj01230  Biosynthesis of amino acids
Module
gdj_M00002  Glycolysis, core module involving three-carbon compounds
gdj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gdia_0154
   00051 Fructose and mannose metabolism
    Gdia_0154
   00562 Inositol phosphate metabolism
    Gdia_0154
Enzymes [BR:gdj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Gdia_0154
Exosome [BR:gdj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Gdia_0154
  Exosomal proteins of bladder cancer cells
   Gdia_0154
  Exosomal proteins of melanoma cells
   Gdia_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACI49954
UniProt: A9HJ86
Position
complement(167508..168251)
Genome map
AA seq 247 aa AA seqDB search
MRQMIVGNWKMNGLGAPSRDLVGEIAEGLATIPSPPQVVVCPPFTQLAGIGPLLKGSGIA
LGAQDCHQAASGAHTGDISAAMLADLGVEYVVLGHSERRRDHGELDETVREKTQTALAAG
LTPIVCIGETGDQKASGESRDAIGWQIQGSLPDGFSGVVAYEPVWAIGSGNPAASQDIAD
MMGFIRAELVRQFGAAGKTIRILYGGSVNGRDAASILPIAEVGGALVGSASLQADTFLPI
VRAAVDL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagatgatcgtcggcaactggaagatgaacggactgggcgccccttcgcgcgac
ctggtcggggagatcgcggagggcctggccaccatcccctcgcctccgcaggtcgtggtc
tgtcccccgttcacccaactggccgggatcggccccctcctgaagggcagcggcatcgca
ctgggggcgcaggactgccatcaggcggcgtcgggcgcgcataccggcgacatatccgcc
gccatgcttgccgaccttggcgtggaatatgtcgtgctgggtcattccgaacggcgccgc
gaccacggcgagctggacgagacggtgcgcgagaagacgcagaccgccctggccgccgga
ctgaccccgatcgtctgcatcggagagaccggcgaccagaaggcgtccggcgaaagccgc
gacgcgatcggctggcagatccagggatcgctgcccgacggtttcagcggcgtcgtggcc
tacgagcccgtatgggcgatcggatcgggcaacccggccgccagccaggacatcgcggac
atgatgggcttcatccgcgccgagctggtgcgtcagttcggtgcggctggaaaaacgatt
cggatcctttatggtggatcggtcaacgggcgcgacgcggcgtccatcctgccgatcgcc
gaggtcggcggcgcgctggtcggcagcgcaagcctgcaggccgacacgtttctgccgatt
gtgcgggccgccgtggacctgtaa

DBGET integrated database retrieval system