KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_0159Help
Entry
Gdia_0159         CDS       T00798                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gdj01100  Metabolic pathways
gdj01110  Biosynthesis of secondary metabolites
gdj01130  Biosynthesis of antibiotics
gdj01230  Biosynthesis of amino acids
Module
gdj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gdia_0159
Enzymes [BR:gdj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Gdia_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: ACI49959
UniProt: B5ZK20
Position
173860..174723
Genome map
AA seq 287 aa AA seqDB search
MMNDMPTSQAPIDCGNTPGQDGIPDVLARICARTRVDVAQRATITPLKDITARAREVDSP
TRGFGQALKQRTADRQIGLIAEIKKASPSAGILRPDYDPAGIAVQYETAGAACISVLTEG
SCFHGCAEDLQRVRKACSLPILRKDFILDPWQVHESRLIGADCILLILAALTDTEASELL
DIARGLDMDVLVEVHDEGELNRALALDTSLIGINNRNLKTLKTDLETTIQLTPLVPPDRI
VVSESGISTHADIVRLSEIGASGFLVGESLLRHDVPGDAARVLLGTV
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgacatgccgacaagccaggcgccgatcgattgcggtaacacgcccggccag
gacgggattcccgatgtcctggcgcggatttgtgcccgcacccgcgtggatgtcgcccag
cgggcgacgatcaccccgctgaaggacatcaccgcccgcgcgcgcgaggtcgactctccc
acccgggggttcggccaggcgctgaagcaacgcacggcggaccggcagatcggcctgatc
gcggagatcaagaaggcatcgccatccgcgggcatcctgcgcccggactacgatccggcc
ggcatcgccgtgcaatatgaaacggcgggcgccgcctgtatctcggtgctgaccgaaggg
tcctgcttccacggctgcgccgaggacctgcaacgggttcgcaaggcatgcagcctgccg
atcctgcgcaaggatttcatcctggacccgtggcaggtccatgaaagccggctgatcggt
gcggactgcatcctgctgatcctggccgccctgacggataccgaggcatcggagctgctg
gacatcgcgcgcggactggacatggacgtgctggtggaagtgcatgacgagggcgaactg
aaccgcgccctggcgctggatacgtccctgattggcattaataaccgaaatctcaagacc
ttgaagaccgatcttgagacaaccatccaactgacccccctggtgccgccggaccggatc
gtggtgtcggagagtggcatcagcacgcacgcggacatcgtccggctgagcgagatcggc
gccagcggcttcctggtcggcgagagcctgctgcgccacgatgtccccggcgacgcggcc
cgcgtgctgctgggcacggtctga

DBGET integrated database retrieval system