KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_0290Help
Entry
Gdia_0290         CDS       T00798                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00860  Porphyrin and chlorophyll metabolism
gdj01100  Metabolic pathways
gdj01110  Biosynthesis of secondary metabolites
gdj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gdia_0290
Enzymes [BR:gdj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Gdia_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACI50087
UniProt: B5ZLF8
Position
complement(319529..320266)
Genome map
AA seq 245 aa AA seqDB search
MPPDAPPRTGVLVTRPEPGLADTMAAVERLGWQAHAMPALRIEPIMDAVLPLARTQAVLL
TSGQAIAALAGRVRPDMPILAVGAVTARRMRDAGFTDVTVAAGTAADLADLARDRLDPGA
GSLLVPTAPTYGQDLAVALRRAGFRVSRRCVYRVRPAGAPDAAVRTALAGGVIDAALFYS
AETARQFLRHLPAGGHAALRNIRAIAISKSTEAALSTATWRAIQVAARPDQAAILDRLGR
RPAGE
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcctgacgcaccgccccgcaccggcgttctggtcacacggccggaacccgggctg
gccgacaccatggcggcggtcgaacggctgggctggcaggcccatgccatgcccgcgctg
cggatcgaaccgatcatggatgccgtgttgccgctggcccgcacccaggccgtcctgctg
accagcgggcaggccatcgcggcgctggcgggccgcgtacggcccgacatgccgattctg
gcggtcggcgcggtcacggcccgacggatgcgcgatgcgggattcaccgacgtcacggtg
gcggcgggaacggcggccgacctggcggacctcgcccgcgaccggctggacccgggggcg
gggtccctgctggtgccgacggcgcccacctatggacaggatctggccgtggcgctgcgg
cgggccgggttccgcgtcagccggcgctgcgtctatcgggtgcggcccgcgggggcgccc
gacgcggcggttcgcacggccctggccgggggcgtcatcgacgcggccctgttctattcg
gccgagacggcacgccagttcctgcgtcacctgccggcgggcgggcacgccgccctgcgg
aacatccgggcgatcgcgatttcaaagtcaaccgaggcggcgctgtccacggcgacctgg
cgtgcgatccaggtcgcggcacgacccgaccaggcggcgatcctggaccggctggggcgg
cgaccggccggggaatga

DBGET integrated database retrieval system