KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_0959Help
Entry
Gdia_0959         CDS       T00798                                 

Definition
(GenBank) P-type conjugative transfer protein TrbG
  KO
K20532  type IV secretion system protein TrbG
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Gdia_0959
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gdj02044]
    Gdia_0959
Secretion system [BR:gdj02044]
 Type IV secretion system
  Trb secretion system protein
   Gdia_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: ACI50743
UniProt: B5ZFJ4
Position
complement(1083760..1084761)
Genome map
AA seq 333 aa AA seqDB search
MRCFIFAALPVALLSLAGCAQHYHPPVIRYDDAARATKIPDPPKPVQVVEVPKPLPLPGQ
LKPLPSRRTLHPAPEVADPTVRVTQANLAARIQPTRAGFINAVQVYPYSPGALYQVYTSP
GEITDIMLQQGEKLVGTGPVAAGDTVRWIIGDTESGAGATKRIHILVKPTRPDLTTNLIV
NTDRRTYLAELRSTPATYMASVSWDYPEDDLIALHRQDSAADDSAPVDVGLDLNALNFRY
AIQPVKGATPPWLPGRAFDDGHKVYIAFPAGIGQGELPPLFVLGADGGPELVNYRVRQNW
MIVDRLFAAAELRLGDKHSEQRVRIVRTDGRRT
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgcttcattttcgcggcccttcctgtggcgctgctgtcgcttgcgggttgcgcg
cagcactaccatccgcctgtcatccgttacgatgacgccgcgcgcgcaacgaaaattccg
gacccaccgaaaccggtgcaggtcgtggaagtcccgaaaccgcttcctctgccggggcag
ctcaagccgctgccctcacgacgcacgctccatccggcccccgaagtcgccgatcccacc
gttcgcgtgacccaggccaatctggcggcgcgcatccagccgacgcgggccggtttcatc
aatgcggtgcaggtctatccctacagccccggcgctctctatcaggtctatacctcgccg
ggtgaaattaccgacatcatgctccagcagggcgagaagctggtcggcaccgggccggtt
gccgccggtgatacggtgcgctggattatcggtgataccgaaagcggggcaggggcgaca
aaacgtatccatattctggtcaagccgacgcggccggacctcacaaccaacctgatcgtc
aacaccgaccggcggacctatctggcggaactgcgctccacgcccgcgacttacatggcg
tcggtctcgtgggattaccccgaggacgacctgattgccctgcatcggcaggacagtgcg
gccgatgactctgcaccggtggatgtagggctggatctgaacgcgctgaatttccgttac
gccatccagccggtgaaaggcgccacaccgccctggctgcctggccgggcgttcgatgat
ggccacaaggtctacatcgcctttccggccggcatagggcagggggaactgccgccgctc
tttgtgctgggggcggatggtggcccggaactggtcaattaccgggtgcggcagaattgg
atgatcgtggaccgtctgttcgcggccgccgaactgcggctgggtgacaagcattccgag
caaagggtgcgcatcgtccgcactgacggacggcggacatga

DBGET integrated database retrieval system