KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_1010
Entry
Gdia_1010         CDS       T00798                                 
Name
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Gdia_1010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gdj02044]
    Gdia_1010
Enzymes [BR:gdj01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Gdia_1010
Secretion system [BR:gdj02044]
 Type IV secretion system
  Trb secretion system protein
   Gdia_1010
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 AAA_10 AAA_29 HerA_C TraG-D_C AAA_16 ABC_tran TrwB_AAD_bind FtsK_SpoIIIE AAA_23
Other DBs
NCBI-ProteinID: ACI50793
UniProt: B5ZFZ1
Position
complement(1136493..1138919)
AA seq 808 aa
MMNLAEYRHRRDRLADFLPWAALVARGVVLNKDGAFQRTARFRGPDLDSSTVSELVAITS
RLNNALRRLGSGWAMFVEAQRRPARGYPASPFPDPASKLVDAERRAQFEEEGAHYESRYF
LTLVWLPPADDAARAEAWLYENRARGGSDWQAVVAGFIDQTDRVLALLDGFMPEADWLDD
GETLTYLHSCISTRLQRVRVPEIPMHLDAILVDEALTGGLEPRLGDAHLRTLTITGFPTQ
TWPGLLDELNRLAFPYRWATRAICLDRTDATKVLGRIRRQWFAKRKSIMAILKEVMTNEA
SVLLDSDAANKAADADAALQELGTDQVGQAYVTATVTVWDEDPTIAANRLRLVEKTIQGR
DFTCMRETVNALEAWFGSLPGHVYANVRQPCVSTLNLAHMIPLSAVWAGPERDGHFDAPP
LFYARTEGSTPFRFALHVGDVGHTLIAGPTGAGKSVLLAFMAMQFRRYANARIFAFDFGG
SIRAATLAMGGDWHDLGGALAQDGNDPVALQPLARIDEPGERAWAAEWVASLLEREGVTV
APDLKEHLWSALTSLASAPVAERTITGLSALLQSLALKQALQPYCVGGPWGSLLDAEHER
LGVADIQAFEIEGLIGSGAASAVLSYLFHRIEDRFDGSPTLLIIDEGWLALDDRAFAGQL
REWLKTLRKKNASVIFATQSLADIDASPIAPALIESCPTRIFLPNDRALEPQITTIYRRF
GLNDRQIEFLSRATPKRDYYCQSRRGNRLFDLGLSEVALAFTAASSPDDQAAIDRIFARH
GRDGFAAAWLMHKGVEWAVEMLNPGEGS
NT seq 2427 nt   +upstreamnt  +downstreamnt
atgatgaaccttgccgaataccgccatcgccgtgaccggctggccgatttcctgccttgg
gcggcgctggtcgcccggggcgtggtgctgaacaaggatggcgccttccagcgcaccgcg
cgctttcgcggcccggacctggactcctcgaccgtgtccgaactggtcgcgatcacgtcg
cggctgaacaatgccctgcgccgtctcggttcgggctgggccatgttcgtcgaggcgcag
cgccgtccggcgcgcggctatcccgccagcccgttcccagatccggcctccaaactggtc
gacgccgaacggcgggcacagttcgaggaagagggcgcccattacgagagccgctatttc
ctcaccctggtctggctgccgccggcggacgatgccgcgcgcgcggaagcctggctttac
gaaaaccgcgcccgtggcggttccgactggcaggccgtggtcgcgggattcatcgatcag
accgaccgggtgctggccctgctcgacggcttcatgcctgaagccgactggctcgatgac
ggcgaaaccctgacgtatctccactcctgtatctcgacgcgcctgcagcgggtgcgggtg
ccggaaatcccgatgcacctcgacgccatcctggtggacgaggcactgaccggcgggctg
gagccgcgcctgggtgacgcccatctgcgcacgctcaccatcaccggtttcccgacccag
acctggccggggctgctggacgagctgaaccggctggcctttccctatcgctgggcgacg
cgggcgatctgcctcgatcgcaccgacgcgacgaaagtgctgggccggatccgccggcaa
tggttcgccaagcgcaaatcgatcatggccatcctcaaggaggtgatgaccaacgaagcc
tcggtgctgctggattccgatgccgccaacaaggccgccgacgccgatgcggcgttgcag
gaactcggtaccgaccaggtcggacaggcctatgtcaccgccaccgtcacggtgtgggac
gaagacccgactatcgccgctaatcggctgcggctggtggagaagaccatccagggccgc
gacttcacctgcatgcgcgagacggtgaatgcgctcgaagcctggttcggcagtctgccg
ggccatgtctacgccaatgtccgccagccctgcgtctccaccctgaacctggcgcacatg
atcccgctctccgccgtgtgggcggggccggagcgtgacgggcatttcgacgcgccaccg
ttattttatgcccgtactgaaggctcgaccccgttccgctttgcactccacgtcggagat
gtcggccacacgctgatcgccgggccgaccggggccggcaagtcggtgctgctggccttc
atggcgatgcagttccgtcgctatgcaaacgcccggatcttcgccttcgatttcggcggc
tcgatccgcgcggcgaccctggcaatgggcggggactggcacgatctcggcggcgcgctg
gcgcaggacgggaacgatcccgtcgcgttgcagccgctggcgcggatcgacgagccgggc
gaacgggcctgggcggcggagtgggtggcgagcctgctggagcgcgagggcgtcactgtc
gcgcccgatctcaaggagcatctgtggtcggcactgacctcgctggcctcggccccggtt
gcggaacgcaccatcaccggcctgtcggcgctgctccagtcgctggccttgaagcaggca
ttgcagccctactgcgttggtggcccatggggcagtctgctcgatgctgagcacgagcgg
ctgggcgtcgccgatatccaggccttcgagatcgagggtctgatcggctcgggtgccgcg
tccgccgtgctgtcttatctgttccatcgtatcgaggaccggtttgacggcagcccgacg
ctgctgatcatcgacgagggctggctggcgctggatgatcgcgctttcgccgggcagttg
cgggaatggctgaaaacgctgcgcaagaagaacgcctccgtcatcttcgccacccagtca
ttggccgatattgacgccagcccgatcgcgcccgccctaatcgaaagctgcccgacccgg
atcttcctgcccaatgaccgggcgctggagccgcagattaccacgatctatcgccgcttc
gggctgaacgaccgccagatcgagttcctcagccgggctacgcccaagcgcgattattac
tgccagtctcggcggggcaaccggctgttcgatctcggcctgtccgaagtggcgctcgcc
tttaccgccgcgtcgtcgcccgacgaccaggccgccatcgaccggatatttgcccggcat
gggcgcgacgggttcgcggcggcatggctcatgcacaaaggtgttgagtgggcggtggag
atgctcaatccgggagaaggttcatga

DBGET integrated database retrieval system