KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_1641Help
Entry
Gdia_1641         CDS       T00798                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00240  Pyrimidine metabolism
gdj00250  Alanine, aspartate and glutamate metabolism
gdj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Gdia_1641
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gdia_1641
Enzymes [BR:gdj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Gdia_1641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACI51418
UniProt: A9GZR7
Position
1826692..1827657
Genome map
AA seq 321 aa AA seqDB search
MTDGPRAAAPRFFPQHARHLLGLQGMHPTRIEPFLDLAESYALMSRSRKTPRDRLLGRTV
INLFFEDSTRTRTSFELAAKRLGADVINMTVASSSVNKGETLLDTAATLNAMRTDLLVVR
HSQSGAPALLARKVEASVVNAGDGTHEHPTQALLDALTIRRHFGTLHGLTVAICGDVSHS
RVARSNIHLLTAMGARVRVVGPPTLIPGAIGALGVDVHYTMEDGLRDVDVVMMLRMQRER
MSGGQVPSAREYFRFYGLDRKRLAVARPGALVMHPGPMNRGVEIDSRVADSDQSVIREQV
EMGVAVRMAVLDLLSRAGDQS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacggtccgcgcgcggcggcaccccgcttcttcccgcagcatgcacggcatctg
ctgggcctgcagggcatgcatccgacccggatcgaaccgttcctggacctggccgaaagc
tatgcgctgatgagccgctcgcgcaagacgccgcgcgaccggctgctggggcgcacggtc
atcaacctgttcttcgaggacagcacccggacgcggacgtcgttcgaactggcggcgaag
cggctgggcgccgacgtgatcaacatgacggtggccagttcgtcggtgaacaagggcgag
actctgctggacacggcggcgacgctgaacgcgatgcggaccgacctgctggtggtgcgc
cattcgcagtccggcgcgccggcgctgctcgcccgcaaggtcgaggccagcgtggtgaat
gccggcgacggcacccacgaacaccccacccaggcgctgctggacgcgctgaccatccgc
cggcatttcggcacgctgcacggcctgacggtggcgatctgcggcgatgtcagccacagc
cgcgtggcacggtcgaacatccacctgctgacggcgatgggggccagggtacgggtggtg
ggaccgcccacgctgatccccggcgcgatcggcgccctgggggtggatgtccattacacg
atggaagacgggctgcgcgacgtggacgtggtgatgatgctgcgcatgcagcgcgagcgc
atgagcggcggccaggtgcccagcgcgcgcgaatatttccgcttctacggcctggaccgc
aagcggctggcggtcgcgcggcccggggcgctggtcatgcatcccggcccgatgaatcgc
ggggtcgagatcgacagccgcgtcgccgattccgaccagagcgtcatccgcgagcaggtc
gagatgggggtggccgtgcgcatggccgtcctggacctgctgtcgcgtgccggagatcag
tcgtga

DBGET integrated database retrieval system