KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_1951Help
Entry
Gdia_1951         CDS       T00798                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00071  Fatty acid degradation
gdj00280  Valine, leucine and isoleucine degradation
gdj00310  Lysine degradation
gdj00362  Benzoate degradation
gdj00380  Tryptophan metabolism
gdj00620  Pyruvate metabolism
gdj00630  Glyoxylate and dicarboxylate metabolism
gdj00640  Propanoate metabolism
gdj00650  Butanoate metabolism
gdj00900  Terpenoid backbone biosynthesis
gdj01100  Metabolic pathways
gdj01110  Biosynthesis of secondary metabolites
gdj01120  Microbial metabolism in diverse environments
gdj01130  Biosynthesis of antibiotics
gdj01200  Carbon metabolism
gdj01212  Fatty acid metabolism
gdj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gdia_1951
   00630 Glyoxylate and dicarboxylate metabolism
    Gdia_1951
   00640 Propanoate metabolism
    Gdia_1951
   00650 Butanoate metabolism
    Gdia_1951
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Gdia_1951
   00072 Synthesis and degradation of ketone bodies
    Gdia_1951
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gdia_1951
   00310 Lysine degradation
    Gdia_1951
   00380 Tryptophan metabolism
    Gdia_1951
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Gdia_1951
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gdia_1951
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Gdia_1951
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gdj04147]
    Gdia_1951
Enzymes [BR:gdj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Gdia_1951
Exosome [BR:gdj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gdia_1951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACI51711
UniProt: B5ZCQ3
Position
complement(2165444..2166625)
Genome map
AA seq 393 aa AA seqDB search
MTSIFVVSAVRSAIGGFGGALRGTAPSVLAARLIAAAVDRAGLPADAVGQVVLGQVIPTE
PADLYLARHAALRAGLPVETVAMNVNRICGSGLQAIISAAQAIRLGDADIAVAGGVEIMS
RAPYLATDARFGGRLGNQTLLDLLVGALTDPFDHVHMGVTAENVATTHGITRAMQDDLAF
ESHRRASAAIRAGRFDGQIVPIEIRANGRATLFDRDEHVRHDAVRADFDALRPAFRKDGG
TITAGNASGINDGAGMVVLASGDAVRRLDLTPLARLVAYGHAGVEPSQMGMGPVPATRRA
LDRAGLGIADLDLLEMNEAFAAQACAVSRVLELDPARVNPNGSGISLGHPIGASGAIATV
RLVHELARIGGRTGLVSLCIGGGQGIAAVFQRP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcatcttcgtcgtctcggccgtacgcagcgcgatcggcggtttcgggggcgcc
ctgcgcggtaccgccccttcggtgctggcggcgcggctgatcgcggccgccgtggaccgg
gccgggctgccggcggatgcggtggggcaggtggtgctgggacaggtgatcccgaccgaa
ccggccgatctgtacctcgcgcgccacgctgcgctgcgggcgggcctgccggtcgagacg
gtggcgatgaacgtcaaccggatctgcggttccggcctgcaggcgatcatatcggccgcg
caggccatccgcctgggcgatgccgatatcgccgtcgccggcggtgtcgaaatcatgagc
cgcgcgccctacctggcgaccgatgcccgtttcggcgggcggctgggcaaccagaccctg
ctggacctgctggtcggcgcgctgacggacccgttcgaccacgtgcatatgggcgtcacg
gcggaaaacgtcgccaccacccacggcatcacccgcgccatgcaggacgacctggcgttc
gaaagccaccgccgggcgtcggcggccatccgcgccggccggttcgacggccagatcgtc
ccgatcgaaatccgcgccaatggccgcgccacgctgttcgaccgggacgagcatgtgcgc
cacgacgccgtccgggcggatttcgatgccctgcgcccggccttccgcaaggatggcggc
acgatcacggccggcaatgcgtcagggatcaatgacggcgccggcatggtcgtgctggcg
tccggggacgcggtgcggcggctggacctgacgccgctggcgcgactggtcgcctatggg
cacgcgggggtggaaccgtcgcagatgggcatgggcccggtccccgccacccgtcgcgcg
ctggatcgcgccggcctgggcatcgcggacctcgacctgctggaaatgaacgaagccttc
gccgcccaggcctgcgccgtcagccgggtgctggaactggaccccgcacgggtcaatccg
aacggcagcggtatctcgctgggccacccgatcggggccagcggcgccatcgccaccgtg
cgcctggtccatgaactggcccgcatcggcgggcgcaccgggctggtcagcctgtgtatc
ggcggcgggcaggggatcgcggcggtgttccagcggccgtga

DBGET integrated database retrieval system