KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_2119Help
Entry
Gdia_2119         CDS       T00798                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00020  Citrate cycle (TCA cycle)
gdj00310  Lysine degradation
gdj01100  Metabolic pathways
gdj01110  Biosynthesis of secondary metabolites
gdj01120  Microbial metabolism in diverse environments
gdj01130  Biosynthesis of antibiotics
gdj01200  Carbon metabolism
Module
gdj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gdj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gdia_2119
  Amino acid metabolism
   00310 Lysine degradation
    Gdia_2119
Enzymes [BR:gdj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Gdia_2119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ACI51878
UniProt: B5ZDZ4
Position
2348127..2349401
Genome map
AA seq 424 aa AA seqDB search
MSAEIKVPTLGESVTTATIAKWLKKPGEAVTADEPVVELETDKVSVEVAAPEAGVMGPQL
VAEGDEVEVGTVLASVEAGSGAAAKPAAAAPAPKKAAEAPKAPAGVQAQPTTSGPVARPA
TPPSDVAAQGAAHAPMPSAQKMMTEKGVTTAEIGIGTGKDGRVTKGDVLAFLSQPPVAKA
AAAPAAPRTDDPREERVKMTRLRRTIARRLKDAQNTAALLTTFNEVDMSAAKAMRAEYRD
LFEKKNGGVKLGFMSIFAKAAIAALKEFPAINAEIDGDDVIYREFINLGIAVGGPNGLVV
PVIRDADKLNFAGIESAIAGFGKRARDGSLKLDELSGGTFSITNGGIYGSLMSTPIVNAP
QSGILGMHAIQDRPVAVNGQVVIRPMMYIALTYDHRIVDGKEAVSFLVRVKQNVEDPRRL
LLEV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgagatcaaggtcccgactctgggcgagagcgtgacgaccgccacgattgcg
aaatggctgaagaagcccggtgaagcggtgacggccgacgaaccggtggtggaactggag
accgacaaggtcagcgtcgaggtcgcggcgcccgaagccggcgtgatgggcccgcaactg
gtggccgagggtgacgaggtcgaggtcggcaccgtcctggcctcggtcgaggccggcagc
ggcgccgccgccaagcccgcggccgctgccccggcgccgaagaaggccgccgaggccccg
aaggccccggccggcgtgcaggcccagccgaccaccagcggccccgtcgcccgtcccgcg
accccgccgtccgacgtcgcggcccagggggcggcccacgcgccgatgccgtcggcccag
aagatgatgaccgaaaagggcgtgacgaccgccgaaatcggaatcggcaccggcaaggac
gggcgcgtgaccaagggtgacgtcctggccttcctgtcgcagccgccggtggccaaggcc
gccgcggccccggccgccccgcgcaccgacgacccgcgcgaggaacgggtgaagatgacc
cgcctgcgccggaccatcgcccgccgcctgaaggacgcgcagaacaccgccgccctgctg
accaccttcaacgaggtggacatgtcggcggccaaggcgatgcgcgccgaatatcgcgat
ctgttcgagaagaagaacggcggcgtgaagctgggcttcatgtcgatcttcgccaaggcg
gccatcgcggcgctgaaggaattcccggcgatcaacgcggaaatcgacggcgacgacgtg
atctatcgcgaattcatcaatctcggcatcgcggtcggcggcccgaacgggctggtcgtg
ccggtcatccgcgacgcggacaagctgaacttcgcggggatcgaaagcgcgatcgcgggc
ttcggcaagcgtgcgcgtgacgggtcgctgaaactggacgaactgtcgggcggcacgttc
tcgatcaccaacggtggcatctacggttcgctgatgtccacgccgatcgtcaatgccccg
cagtcgggcatcctgggcatgcatgccatccaggaccgtccggtcgccgtgaacggccag
gtcgtgatccggccgatgatgtacatcgccctgacctacgatcaccgcatcgtcgacggc
aaggaggctgtcagcttcctggtgcgcgtcaagcagaacgtggaagacccgcgtcgtctg
ctgctcgaggtctga

DBGET integrated database retrieval system