KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_2286Help
Entry
Gdia_2286         CDS       T00798                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Gdia_2286
Enzymes [BR:gdj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     Gdia_2286
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     Gdia_2286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: ACI52041
UniProt: A9H2J8
Position
2539447..2540451
Genome map
AA seq 334 aa AA seqDB search
MTAPSSCHTRPLAVTMGDPAGIGPEIAARMFLRRPAQRCWIVVGDPLVMRHALAARDPAA
RMRRIATPAEARFDDGVLNVLASSECVALPPIGRVSAESGRAAYAAIRTAIRLARDGAIR
GIVTAPIHKEALAAAGLPYPGHTEILAEQAGGARVAMMLANEDIRVVLVTIHCSLRDAIR
RADQSAQMAAIRLAHAGARALGVECPRVAVAGLNPHAGEGGLFGEEETRIIAPAIAQARS
EGIDASGPWPGDTVFMQARQRRFDVVVAQYHDQGLIPVKYMGLAQGVNITLGLPFIRTSP
DHGTAFDIAGRGVADPSSLETAFDYALRLTGAAT
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaccctcctcctgccacacccggccgctggccgtcacgatgggcgatcccgcc
gggatcgggccggagatcgcggcccggatgttcctgcggcggccggcgcaacgatgctgg
atcgtggtcggtgatccgctggtgatgcgccacgccctggccgcgcgcgatccggcggcg
cggatgcgccgcatcgcgacgccggccgaagcccggttcgatgacggggtgctgaacgtc
ctggcgtcatcggaatgcgtggccctgccgcccataggccgtgtcagcgccgaaagcggc
cgcgccgcctatgcggcaatccgcaccgccatacggttggccagggatggcgcaatccgg
ggcatcgtcaccgcgccgatccacaaggaagcgctcgccgccgccggattgccgtacccc
ggccatacggaaatcctcgccgaacaggccggcggcgcgcgtgtcgccatgatgctggcg
aacgaggatatccgcgtcgtgctggtgaccatccattgttcgctgcgggacgcgatccgc
cgcgccgatcaatccgcacagatggcggcgatccgcctcgcccacgcgggcgcacgcgcg
ctgggcgtcgaatgcccgcgcgtcgccgtggcgggcctcaatccccatgccggggaaggc
ggcctgttcggcgaggaggaaacccgcatcatcgcgcccgccatcgcacaggcgcggagc
gagggcatcgatgcgtccggcccgtggcccggcgacacggtgttcatgcaggcgcggcag
aggcgcttcgatgtcgtggtggcgcaatatcacgaccaggggctgattccggtgaaatat
atgggcctggcgcagggcgtgaacatcacgctcggcctgcccttcatccgcaccagcccc
gaccacggcaccgccttcgatatcgcgggacgcggcgttgccgatccgtccagcctggag
acggctttcgattacgcccttcgcctcaccggagccgcgacatga

DBGET integrated database retrieval system