KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_3352Help
Entry
Gdia_3352         CDS       T00798                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00860  Porphyrin and chlorophyll metabolism
gdj01100  Metabolic pathways
gdj01110  Biosynthesis of secondary metabolites
gdj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gdj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gdia_3352
Enzymes [BR:gdj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Gdia_3352
Exosome [BR:gdj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gdia_3352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACI53079
UniProt: A9HRP9
Position
complement(3670028..3671023)
Genome map
AA seq 331 aa AA seqDB search
MTLGRFPATRPRRNRQDDFTRRLVAETTLTVDNLIWPIFVMEGTDTQTEVASMPGVRRVT
LDRLAAHVEPAAALGIPALALFPITPTSLRDAEGTEAMNPDNLMCRAARVLKREFPDMGL
IGDVALDPYTDHGHDGLIRDGYVVNDESVAVLSRQAVNQAAAGIDIIAPSDMMDGRIGVI
RRDLDAQGLTGTRIMSYAAKYASAFYGPFRDALGSGGLLKGDKKTYQMDPANSDEALREV
EQDLAEGADMVMVKPGMPYLDIIRRVHDRFAVPTFAYQVSGEYAMLTAAMDHGWLDRDRT
MLESLMAFRRAGASGVLTYFAVDAARRLRGG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcggccgctttcccgccacccgtccgcgccgcaaccgccaggacgatttcacc
cgacgcctggtcgcggaaacgacgctgacggtcgacaacctgatctggccgatcttcgtc
atggaaggcaccgacacgcagaccgaggtcgcctcgatgcccggcgtgcgccgggtgacg
ctggaccggctggcggcccatgtcgaaccggcggcggcgctgggcattccggccctggcg
ctgttcccgatcacccccacctccctgcgcgacgcggaggggaccgaggcgatgaacccc
gacaacctgatgtgccgggcggcgcgcgtgctgaagcgtgaattccccgacatgggcctg
atcggggacgtggcgctggacccctataccgaccatgggcatgacggactgatccgcgac
ggatatgtcgtcaacgacgaatccgtcgccgtcctgtcgcggcaggcggtcaaccaggcg
gcggccggcatcgacatcatcgcgccgtccgacatgatggacggccgcatcggcgtcatc
cgccgcgacctggacgcgcagggcctgaccggcacgcggatcatgtcctatgccgccaaa
tatgccagcgcgttctatggcccgttccgcgacgcgctgggatcgggcgggctgctgaag
ggcgacaagaagacctaccagatggacccggccaacagcgacgaggccctgcgcgaggtg
gagcaggacctggccgagggggcggacatggtcatggtcaagcccgggatgccgtatctg
gacatcatccgccgggtccatgaccgcttcgcggtgccgaccttcgcgtaccaggtatcg
ggcgaatacgcgatgctgaccgcagccatggaccatggctggctggaccgcgaccgcacc
atgctggaaagcctgatggccttccgccgcgccggcgccagcggggtgctgacctatttc
gcggtggacgccgcacgccggctgcggggcggctga

DBGET integrated database retrieval system