KEGG   Geobacillus sp. 12AMOR1: GARCT_00138Help
Entry
GARCT_00138       CDS       T03966                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gea00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GARCT_00138 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gea03011]
    GARCT_00138 (rplV)
Ribosome [BR:gea03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GARCT_00138 (rplV)
  Bacteria
    GARCT_00138 (rplV)
  Archaea
    GARCT_00138 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AKM17497
UniProt: A0A0G3XT63
Position
132179..132520
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKARLVIDLIRGKEVGEAFAILRHTPKAASPIIEKVLKSAVANAEH
NYDMDVNNLVISQAYVDEGPTLKRFRPRAMGRASAINKRTSHITIVVSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagctgttgcgagaaccgttcgcatcgctcctcgtaaagcgcgcttagtc
attgacttgatccgtgggaaggaagtgggcgaagcattcgcgattttgcgccacacgcca
aaagcggcttccccgatcattgaaaaagtgttgaaatcggctgttgccaacgctgaacac
aactatgacatggacgtcaacaacctggtcatttcccaagcgtacgttgatgaaggtcca
acgttgaaacgtttccgtccgcgtgcgatgggccgggcaagcgccattaataaacgcaca
agccatattacaatcgtcgtgtcagaaaagaaggagggataa

DBGET integrated database retrieval system