KEGG   Geobacillus sp. 12AMOR1: GARCT_00449Help
Entry
GARCT_00449       CDS       T03966                                 

Gene name
sirB
Definition
(GenBank) Sirohydrochlorin ferrochelatase
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00860  Porphyrin and chlorophyll metabolism
gea01100  Metabolic pathways
gea01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GARCT_00449 (sirB)
Enzymes [BR:gea01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     GARCT_00449 (sirB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiX CbiK Ferrochelatase
Motif
Other DBs
NCBI-ProteinID: AKM17776
UniProt: A0A0G3XVZ0
Position
complement(447983..448729)
Genome map
AA seq 248 aa AA seqDB search
MEAILYVSHGSRVPAARREAARFVEQCKAAIDIPIQELCFVELAEPDIATGVDRCAAQGA
TRVIVIPLLLLSAGHAKQDIPAALKAAKQRHPSLEIVCGAPFGVHDAMIDIIIDRIGEQP
APLDHESMVLLIGRGSSDPDTKRDIAAIARRLQEKTSVPHVDVCFLAAIRPTLDEGFKRA
QASIYRRVFIVPYLLFTGVLMKTVERKLQAMPVSDQQWHLCSYLGYHPRLVTLIQQQVQA
LSAAKKGA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggaagccattttgtacgtcagccacggcagccgggttccggctgcgcgccgagaagca
gcccgcttcgttgaacaatgcaaggcggccatcgacatcccgattcaagaactgtgcttc
gttgagctggctgagccggatattgcgaccggcgttgaccgttgcgccgcccaaggggca
acccgtgtgatcgtcatcccgttgctgcttctatccgccggacatgccaaacaggacatt
ccggctgcgcttaaagcagcgaaacagcgccatccgtctttggagatcgtctgcggagcg
ccgtttggcgtccacgatgcaatgattgacatcatcatcgaccgcatcggcgagcagccg
gcgccgcttgatcatgaatcaatggttctgctgattggccgcggcagcagcgacccggat
acgaagcgcgacatcgccgccatcgcccggcgcttgcaagaaaaaacgagcgtgccgcac
gttgacgtttgttttctcgccgccatccgcccgacgcttgacgaagggttcaagcgggcg
caggcatccatataccggcgcgtctttatcgtgccgtatttgctgtttaccggcgtttta
atgaaaacagtcgaacggaagctgcaagcgatgcctgtttccgatcaacagtggcattta
tgctcatacttagggtatcatccgcggcttgtaacgctcattcaacaacaggtgcaggcg
ctgtcggcagcgaaaaaaggagcttga

DBGET integrated database retrieval system