KEGG   Geobacillus sp. 12AMOR1: GARCT_01099Help
Entry
GARCT_01099       CDS       T03966                                 

Gene name
cfiB_1
Definition
(GenBank) 2-oxoglutarate carboxylase small subunit
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00020  Citrate cycle (TCA cycle)
gea00620  Pyruvate metabolism
gea01100  Metabolic pathways
gea01120  Microbial metabolism in diverse environments
gea01200  Carbon metabolism
gea01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GARCT_01099 (cfiB_1)
   00620 Pyruvate metabolism
    GARCT_01099 (cfiB_1)
Enzymes [BR:gea01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     GARCT_01099 (cfiB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 ATP-grasp Dala_Dala_lig_C ATP-grasp_3 HlyD_D23 HlyD_3 ATP-grasp_4 RimK RnfC_N GCV_H ATPgrasp_Ter YqfD NQRA
Motif
Other DBs
NCBI-ProteinID: AKM18393
UniProt: A0A0G3XX49
Position
1078511..1081954
Genome map
AA seq 1147 aa AA seqDB search
MRTRRIHKVLVANRGEIAIRVFRACTELDIRTVAIYSKEDAGSYHRYKADEAYLVGEGKK
PIEAYLDIEGIIEIAKAHDVDAIHPGYGFLSENIQFAKRCREEGIIFIGPNEDHLDMFGD
KVKARHAAMKAGIPVIPGSDGPVGGLEDVVRFAETHGYPIIIKAALGGGGRGMRIVRSKS
EVKEAFERAKSEAKAAFGSDDVYVEKLIEKPKHIEVQILGDHEGNIVHLYERDCSVQRRH
QKVVEVAPSVSLSDELRQRICEAAVKLMKSVGYVNAGTVEFLVSGDEFYFIEVNPRIQVE
HTITEMITGIDIVQSQILIADGFSLHSPEVGIPKQEDIRINGYAIQSRVTTEDPLNNFMP
DTGKIMAYRSGGGFGVRLDAGNGFQGAVITPYYDSLLVKVSTWALTFEQAARKMLRNLRE
FRIRGIKTNIPFLENVVQHPKFLSGEYDTSFIDTTPELFVFPRRKDRGTKMLTYIGTVTV
NGFPGIGKKKKPVFDKPRVPKLSETEPIPAGTKQILDERGPEGLVRWIQEQPRVLLTDTT
FRDAHQSLLATRVRTIDLLRIAEPTARLLPNLFSLEMWGGATFDVAYRFLKEDPWDRLLK
LRERIPNVLFQMLLRSANAVGYKNYPDNVIREFVDKSAQAGIDVFRIFDSLNWVKGMTVA
IDAVRQSGKIAEAAICYTGDILDPSRPKYNLDYYKALAKELEQAGAHILGIKDMAGLLKP
QAAYVLISALKETVDIPIHLHTHDTSGNGIYTYAKAIEAGVDIVDVAVSSMAGLTSQPSA
NTLYYALEGTERAPEVDIYGLEQLARYWEDVRKFYQEFESGMNAPHTEVYMHEMPGGQYS
NLQQQAKAVGLGDRWDEVKEMYRRVNDLFGDIVKVTPSSKVVGDMALYMVQNNLTEQDIF
ERGETLNFPDSVVEFFEGYLGQPHGGFPKELQRIILKGREPITVRPGELLEPVDFEQIKR
ELYDKLGREVTDFDAIAYALYPKVFLEYAETVEKYGDISVLDTPTFLYGMRLGEEIEVEI
ERGKTLIVKLVSIGQPQADGTRVVYFELNGQPREVIIRDESIKAAVAERIKADRTNPNHI
AATMPGTVVKVLVEKGEKVDKGDHLMVTEAMKMETTVQAPFAGIVKDIYVKSGDAIQAGD
LLIELSK
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atgaggacaagacgaattcacaaagtgcttgtagccaaccgcggggagatcgccattcgc
gtcttccgcgcctgcacggagcttgatatccgcaccgtggcgatttattcgaaggaagac
gccggatcgtaccaccgctacaaagcggatgaggcgtatttagtcggggaagggaaaaag
ccgattgaagcgtatttggacatcgagggcatcatcgaaatcgccaaagcccacgatgtt
gatgccatccatccggggtacgggtttttgtcggaaaatatccaatttgcgaaacggtgc
cgcgaggaagggattattttcatcggcccgaacgaggatcacctcgacatgtttggcgac
aaggtaaaagcgcgccatgcggccatgaaggcgggcattccggtcatcccgggcagcgac
ggaccggtcggcggccttgaggatgtcgtccgctttgccgaaacgcacggatatccgatc
atcatcaaggcggcgctgggcggcggcggacgcggcatgcgcatcgtccgctcaaagtcg
gaagtgaaggaagcgtttgagcgggctaagtcggaagcgaaagcggcgtttggcagcgat
gacgtttatgtcgaaaagctgattgaaaagccgaagcatattgaagtgcaaattttgggc
gaccatgaaggaaacattgtccatctttacgaacgtgactgctcggtgcagcgccgccac
caaaaagtcgttgaggttgcgccgagcgtctcgctgtcggacgagctgcgccagcgcatt
tgtgaagcggcggtcaaactgatgaaaagcgtcggctacgtcaacgccggtacggttgag
ttccttgtctcaggcgatgaattttatttcattgaggtcaatccgcgcatccaagtcgag
catacgatcaccgaaatgatcacggggattgacatcgtccagtcgcaaattttaatcgcc
gacggcttttcactccacagcccggaagtcggcattcccaagcaggaggacatccgcatt
aacggctatgcgattcagtcgcgggtgacgactgaggacccgctcaacaactttatgccg
gatacgggaaaaattatggcgtaccgctcaggcggcggttttggcgtgcgcttggacgcc
ggcaatggcttccaaggagcggttattacgccgtattacgattcgctgctcgtgaaagtg
tcgacatgggcgttgacgtttgagcaggcggccagaaaaatgctgcgcaacttgcgcgaa
ttccgcattcgcggcattaaaacgaacattccgtttttggaaaacgtcgtgcagcatccg
aagtttttgtcgggggaatacgatacgtcatttatcgatacgacgccggaattgtttgtg
tttccgcgccggaaagaccgcgggacgaaaatgctcacctacatcggcacggtgacggtc
aacggcttccctggcatcggcaaaaagaaaaagccggtgtttgacaagccgcgcgtgccg
aaattgagcgaaaccgaaccgatcccagcgggaacgaagcaaattttggatgaacgcgga
cctgaagggcttgttcgctggatccaagagcagccgcgcgtgctcttgaccgatacgacg
ttccgtgacgctcatcagtcgctgttggcgacccgcgtccgcacgatcgacttgttgcgg
atcgctgagccgacggcgcgcctgctgcccaacttattctcgcttgagatgtggggcggg
gcgacgtttgatgtggcgtaccgctttttgaaagaagatccgtgggaccggctgctcaag
ctgcgcgagcgcatcccgaacgtgctgttccagatgcttcttcgctcggccaacgccgtg
gggtataaaaactatcccgacaacgtcatccgcgagttcgttgacaaatcggcgcaagcc
ggcattgatgtgttccgcattttcgacagcctaaactgggtgaaagggatgacggtggcg
atcgatgccgtccggcaaagcggcaaaatcgccgaggcggctatttgctatacaggcgat
attttggacccgagccggccgaagtacaatttggattattacaaagccttggcgaaagag
ctcgagcaagccggtgcgcacattttaggcattaaggatatggccggcctgttgaagccg
caggcggcgtacgtgctcatttccgcgctcaaggaaacggtcgacattccgatccatttg
catacgcacgatacgagcggcaacggcatttacacgtacgccaaagcgatcgaagccggc
gtcgatatcgtcgatgtcgccgtcagctcgatggccggcttgacgtcacagccgagcgcc
aatacgctctactatgcccttgaaggaacggagcgggcgccggaggttgatatttacggc
cttgagcagttggcccgctattgggaagacgtgcgcaaattttatcaggagtttgaaagc
ggcatgaacgcgccgcatacggaagtatacatgcatgagatgccaggcggccagtacagc
aacctgcagcagcaggcaaaagcggtcggcctcggcgatcggtgggatgaagtgaaagaa
atgtatcgccgcgtcaacgacttgttcggcgatatcgttaaagtgacgccgtcatcgaaa
gtcgtcggcgacatggcgctttacatggtgcaaaacaatttgacggagcaagacattttt
gaacgcggcgaaacgctcaatttcccagactcggtcgtggagtttttcgaaggctattta
ggccagccgcacggcgggttcccgaaagagttgcagcgcattattttgaaagggcgcgaa
ccgatcaccgttcgtccgggcgagttgcttgagccggttgatttcgagcaaatcaagcgg
gagctgtatgacaagctcggccgcgaagtgaccgactttgacgccattgcctatgcgctt
tatccgaaagtgtttttggaatatgccgaaacggtcgaaaaatacggcgatatttccgtg
ctcgatacaccgacgttcctgtacggcatgcgcctcggcgaggaaattgaagtggagatt
gagcgcgggaaaacgctcatcgtcaaactcgtctccatcggccagccgcaggccgatggc
acgcgcgtcgtctacttcgagctgaacggccagccgcgcgaagtcatcatccgcgatgag
agcatcaaagcggccgttgctgagcgcatcaaggccgaccggacgaatccgaaccatatt
gcggcgacgatgccgggtacggttgtgaaagtgcttgtcgaaaaaggggagaaagtggat
aaaggcgaccatttgatggtcacggaagcgatgaaaatggaaacgacggtgcaggcgccg
tttgctggcattgtcaaagacatttacgtcaaaagcggcgatgccattcaggcgggcgac
ttgctgattgagctatccaaataa

DBGET integrated database retrieval system