KEGG   Geobacillus sp. 12AMOR1: GARCT_02372Help
Entry
GARCT_02372       CDS       T03966                                 

Definition
(GenBank) Farnesyl diphosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00900  Terpenoid backbone biosynthesis
gea01100  Metabolic pathways
gea01110  Biosynthesis of secondary metabolites
gea01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GARCT_02372
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:gea01006]
    GARCT_02372
Enzymes [BR:gea01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     GARCT_02372
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     GARCT_02372
    2.5.1.29  geranylgeranyl diphosphate synthase
     GARCT_02372
Prenyltransferases [BR:gea01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   GARCT_02372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AKM19624
UniProt: A0A0G3Y1M7
Position
complement(2342090..2342983)
Genome map
AA seq 297 aa AA seqDB search
MAQLSVEQFLNEQKQAVETALSRYIERLEGPAKLKKAMAYSLEAGGKRIRPLLLLSTVRA
LGKDPAVGLPVACAIEMIHTYSLIHDDLPSMDNDDLRRGKPTNHKVFGEAMAILAGDGLL
TYAFQLIAEIDDERIPPSVRLRLIERLAKAAGPEGMVAGQAADMEGEGKTLTLSELEYIH
RHKTGKMLQYSVHAGALIGGADARQTRELDEFAAHLGLAFQIRDDILDIEGAEEKIGKPV
GSDQSNNKATYPALLSLAGAKEKLAFHIEAAQRHLRHADVDGAALAYICELVAARDH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcagctttcagttgaacagtttctcaacgagcaaaaacaggcggtggaaacagcg
ctctcccgttatatagagcgcttagaagggccggcgaagctgaaaaaggcgatggcgtac
tcattggaggccggcggcaaacgaatccgtccgttactgcttctgtccaccgttcgggcg
ctcggcaaagacccggcggtcggattgcccgtcgcctgcgcgattgaaatgatccatacg
tactctttgatccatgatgatttgccgagcatggacaacgatgatttgcggcgcggcaag
ccgacgaaccataaagtgttcggcgaggcgatggccatcttggcgggggacgggttgttg
acgtacgcgtttcaattgatcgccgaaatcgacgatgagcgcatccctccttccgtccgg
cttcggctcatcgaacggctggcgaaagcggccggtccggaagggatggtcgccggtcag
gcagccgatatggaaggagaggggaaaacgctgacgctttcggagctcgaatacatccat
cggcataaaaccgggaaaatgctgcaatacagcgtgcacgccggcgccttgatcggcggc
gctgatgcccggcaaacgcgggagcttgacgaattcgccgcccatctaggccttgccttt
caaattcgcgatgatattctcgatattgaaggggcagaagaaaaaatcggcaagccggtc
ggcagcgaccaaagcaacaacaaagcgacgtatccagcgctgctgtcgcttgccggcgcg
aaggaaaagttggcgttccatatcgaggcggcgcagcgccatttacggcacgccgacgtt
gacggcgccgcgctcgcctatatttgcgaactggtcgccgcccgcgaccattaa

DBGET integrated database retrieval system