KEGG   Geobacillus sp. 12AMOR1: GARCT_02685Help
Entry
GARCT_02685       CDS       T03966                                 

Gene name
hemL
Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00860  Porphyrin and chlorophyll metabolism
gea01100  Metabolic pathways
gea01110  Biosynthesis of secondary metabolites
gea01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GARCT_02685 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gea01007]
    GARCT_02685 (hemL)
Enzymes [BR:gea01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     GARCT_02685 (hemL)
Amino acid related enzymes [BR:gea01007]
 Aminotransferase (transaminase)
  Class III
   GARCT_02685 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 HTH_psq
Motif
Other DBs
NCBI-ProteinID: AKM19936
UniProt: A0A0G3Y241
Position
complement(2611373..2612665)
Genome map
AA seq 430 aa AA seqDB search
MRSYERSKGAYSEALKLMPGGVNSPVRAFKSVGMTPIFMARGQGSKIYDIDGNEYIDYVL
SWGPLILGHAHPHVVEALKRVAEQGTSFGAPTLLENELAKLVIERVPSVEIVRMVNSGTE
ATMSALRLARGYTKRNKIIKFEGSYHGHGDSLLIKAGSGVATLGLPDSPGVPESVAQHTI
TVPYNDLDSVRYAFERFGEDIAAVIVEPVAGNMGVVPPVPGFLEGLRDVTKQYGALLIFD
EVMTGFRVDYHCAQGYYGVEPDLTCLGKVIGGGLPVGAYGGKAEIMELVAPSGPVYQAGT
LSGNPLAMIAGYETLRQLTPETYEEFKRKAARLEEGLRQAAEKYDIPHTINRAGSMIGLF
FTNEPVVNYETAKTSDLELFAAYYREMANEGIFLPPSQFEGLFLSTAHSDEDIEYTIAAA
ERVFARLRGA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaagctatgaacggtcaaaaggcgcctacagcgaggcgctcaagctgatgccgggc
ggggtgaacagcccggtgcgcgccttcaagtcggtcggcatgacgccgatctttatggcg
cgcggccaaggttcgaaaatttatgatattgacggcaacgaatatatcgactatgtgttg
tcgtgggggccgctcattttagggcatgcccatccgcacgttgtggaagcgttaaagcgc
gtggcggaacaagggacgagctttggcgccccgacgctgctcgaaaatgagttggccaaa
ctcgtcatcgagcgggtgccgtcggttgaaatcgtgcgcatggtcaactccggaacggag
gcgacgatgagcgcgcttcgtctcgcgcgcggctacacgaagcgcaacaaaattatcaaa
ttcgaaggcagctaccatggccatggcgattcgctgctcattaaagccggctccggcgtg
gcgacgctcggcctgccggacagcccgggcgtgccggagtcggtcgcccagcatacgatc
accgttccgtataacgatttagacagcgttcgctacgcgtttgagcggtttggcgaagac
atcgccgcggtgatcgtcgaaccggtcgccggcaacatgggtgtcgtgccgccggtgcct
ggttttttggaagggctgcgggacgtgacgaaacaatacggcgccttattgattttcgac
gaggtcatgaccggcttccgcgtggactaccattgcgcccaagggtattatggcgttgag
ccggatttgacgtgtctcggcaaagtgatcggcggcggcctgccggttggagcgtatggg
ggaaaagcagaaattatggagctcgtcgcaccgagcgggccggtgtaccaagcaggcacg
ctgtccggcaacccgcttgccatgatcgccggttacgagacgcttcgccagttgacgccg
gaaacgtatgaagagttcaagcgcaaagcggcgcgccttgaagaagggttgcgccaggcc
gccgaaaaatatgacattccgcatacgatcaaccgtgccgggtcgatgatcggcttgttc
ttcacgaacgaaccggtggtcaattacgaaacggcgaaaacgtccgacttggagctgttt
gccgcttattaccgggaaatggcgaatgaaggcattttcttgcccccgtcgcaatttgaa
gggctgtttttgtcgacggcgcacagcgatgaggatatcgagtacacgattgccgcagcg
gagcgggtgtttgcccgcctgcgcggggcgtga

DBGET integrated database retrieval system