KEGG   Geobacillus sp. 12AMOR1: GARCT_02923Help
Entry
GARCT_02923       CDS       T03966                                 

Gene name
aacA-aphD
Definition
(GenBank) Bifunctional AAC/APH
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
gea  Geobacillus sp. 12AMOR1
Brite
KEGG Orthology (KO) [BR:gea00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:gea01504]
    GARCT_02923 (aacA-aphD)
Enzymes [BR:gea01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     GARCT_02923 (aacA-aphD)
Antimicrobial resistance genes [BR:gea01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    GARCT_02923 (aacA-aphD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH DUF1679 EcKinase YolD
Motif
Other DBs
NCBI-ProteinID: AKM20170
UniProt: A0A0G3Y0J2
Position
2849778..2850686
Genome map
AA seq 302 aa AA seqDB search
MLSNIIDMLDYIKKQLPWLEIQEYDINNEGWDNAVLIINKEWIFRFPRSEDTAQHLLNEK
LLLDFLQTEISYLSIKLPKYRLIFKDNRPICCYYSLINGVPLSPSILYELDDQTQNQIAF
QISSFLTMLHKVDLEEIHSIELKDNQGYTYWKEHWENIKKLVYPYLTEQECQKITNMFES
FLNQISINPLPKTIIHGDLTHKHILFDINKKQISGIIDFGDIQLGDPAYDLSGLYWDYGE
QFFNKILNYYSYPFKDLNYPIDKRVTSFYGKRLIFHDLLYAIEKKSVKDFNNGLKLLKQS
LV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtaatattattgacatgttagattatattaagaaacagttaccatggttagaa
atccaggaatatgatattaataatgaaggatgggacaatgctgttctgataatcaataaa
gaatggatttttcgctttccgagaagtgaagacacagcacagcatttactaaacgaaaag
cttttgttggattttttacagactgaaatatcttatttaagcataaaattaccaaaatac
cgattaatttttaaagataataggcctatctgttgctattactcactaattaacggtgtt
cctctgtctccttctattctttacgagttggacgatcagactcaaaatcagatagccttt
cagataagcagctttttaacaatgttacataaagttgatttagaggaaatacattctata
gaacttaaagataaccaaggatatacttactggaaagagcactgggagaacataaaaaaa
ctggtatatccataccttacagaacaagaatgtcaaaaaataactaacatgtttgagtct
tttctaaaccaaatatcaataaatcctttacctaaaactattattcatggtgatttgact
cataaacatatactgtttgatattaataaaaaacaaattagtggcattattgactttgga
gatattcaattaggtgaccccgcttatgatttatctggactatattgggactatggagaa
caattctttaataagattcttaactattacagttatccttttaaagaccttaattatcca
atcgataagcgtgttacatcattttatggaaaaagattgatattccatgatctcctttat
gcaattgaaaaaaaatcagtgaaagattttaacaacggactcaaattgctaaagcagtct
cttgtataa

DBGET integrated database retrieval system