KEGG   Geobacillus sp. 12AMOR1: GARCT_03002Help
Entry
GARCT_03002       CDS       T03966                                 

Gene name
yutF
Definition
(GenBank) putative hydrolase YutF
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00627  Aminobenzoate degradation
gea01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GARCT_03002 (yutF)
Enzymes [BR:gea01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     GARCT_03002 (yutF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase CdiI_3
Motif
Other DBs
NCBI-ProteinID: AKM20231
UniProt: A0A0G3Y2X2
Position
complement(2913674..2914444)
Genome map
AA seq 256 aa AA seqDB search
MKRYKGYLLDLDGTMYRGAECIAEAREFVNELHRRSLPYLFVTNNSSRTPAQVAEKLRSF
GVPAEERHVFTTSQATANYIFERKPDASVYVIGEEGIRTALAEKGFRFAGEDADVVVIGI
DRQLTYEKLAIACLAVRNGAMFISTNGDIALPTERGLLPGNGAITSVVAVSTQVKPTFIG
KPENIIMEQALKVLGVPKEDVLMIGDYYETDILAGMNAGIDTLLVHTGVTTKEMLARYER
QPTYTADSLREWMERL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgatacaaaggctatttgcttgacttggacgggacaatgtaccgcggcgcagaa
tgcatcgccgaggcgcgcgagtttgtgaacgagctgcaccgccgcagcctcccgtatttg
tttgtcacgaacaactcgtcgcgcacgccggcgcaagtggcggaaaaattgcgctcattc
ggcgtgccggcggaagagaggcatgtcttcacaacaagccaggcgacggcgaactacatt
tttgagcgaaagccggacgcgtccgtttatgtcatcggcgaggaagggatccgcaccgcg
ttggcggaaaaagggttccgcttcgctggggaggacgcagacgtggtggtcatcggcatc
gaccgccagctgacgtacgagaagcttgccatcgcgtgccttgccgtccgcaacggggcg
atgttcatttcgacaaacggcgacatcgccttgccgaccgagcgcgggctgctgccgggc
aacggcgccatcacgtccgtcgtcgccgtttcgacgcaagtgaagccaacgtttatcggc
aagccggaaaacatcattatggagcaggcgcttaaggtgcttggcgttccaaaggaagat
gtgttgatgatcggcgactattacgagacggatattttagccggcatgaacgcgggcatc
gatacgctgctcgtccatacgggcgtcacgacgaaagagatgctcgcccgctacgaacgg
cagccgacctatacggctgattcgctccgcgaatggatggagcgcctgtaa

DBGET integrated database retrieval system