KEGG   Geobacillus sp. 12AMOR1: GARCT_03380Help
Entry
GARCT_03380       CDS       T03966                                 

Gene name
mmgA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00071  Fatty acid degradation
gea00072  Synthesis and degradation of ketone bodies
gea00280  Valine, leucine and isoleucine degradation
gea00310  Lysine degradation
gea00362  Benzoate degradation
gea00380  Tryptophan metabolism
gea00620  Pyruvate metabolism
gea00630  Glyoxylate and dicarboxylate metabolism
gea00640  Propanoate metabolism
gea00650  Butanoate metabolism
gea00900  Terpenoid backbone biosynthesis
gea01100  Metabolic pathways
gea01110  Biosynthesis of secondary metabolites
gea01120  Microbial metabolism in diverse environments
gea01130  Biosynthesis of antibiotics
gea01200  Carbon metabolism
gea01212  Fatty acid metabolism
gea02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GARCT_03380 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    GARCT_03380 (mmgA)
   00640 Propanoate metabolism
    GARCT_03380 (mmgA)
   00650 Butanoate metabolism
    GARCT_03380 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GARCT_03380 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    GARCT_03380 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GARCT_03380 (mmgA)
   00310 Lysine degradation
    GARCT_03380 (mmgA)
   00380 Tryptophan metabolism
    GARCT_03380 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GARCT_03380 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GARCT_03380 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GARCT_03380 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gea04147]
    GARCT_03380 (mmgA)
Enzymes [BR:gea01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GARCT_03380 (mmgA)
Exosome [BR:gea04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GARCT_03380 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF2496 SpoVAD
Motif
Other DBs
NCBI-ProteinID: AKM20605
UniProt: A0A0G3Y1P1
Position
complement(3309157..3310335)
Genome map
AA seq 392 aa AA seqDB search
MGKTVIVSGVRTPFGKLGGALQALSAPELGGVAVKEALVRANVSAEQVDHVILGTVLQGG
QGQLPSRQAMRHAGIPWHVRTETVNKVCASGMRAVTLADQLIRLGEADIIVAGGMESMSN
APYVLPKARWGLRMGDSTVKDLMVYDGLTCSFTGVHMGVYGGNTAKELGITREAQDEWAY
RSHMRAIAAIEAGRLAEEIVPVSIPQRKGEPLVVERDEAPRKDTSLEALAKLKPVFDPEG
TITAGNAPGVNDGAAALVLMSQERAAREGLEPLATVVAHTAIAVEAKDFPKTPGLVINEL
LRKTGKTVDDIDLFEVNEAFAAVALAAIQIAGLDPEKVNVNGGAVALGHPIGASGARIIL
TLAHELKRRGGGLGIAAICSGGGQGDAILIEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaacagtgattgtgagcggggtgcgcaccccgtttggaaaattgggcggcgcc
ttgcaagcgctgtcagcgcctgagctcggcggcgtcgccgtcaaagaggcgcttgtccgc
gccaacgtgagcgccgaacaagttgatcatgtcattttgggcaccgtcttgcaaggcgga
caagggcagcttccgtcgcggcaggcgatgcgccatgccggcattccgtggcacgtccgc
accgagacggtgaacaaagtatgcgcgtccggcatgcgcgccgtgacgcttgccgatcag
ctcatccgtttaggcgaggctgatatcatcgtcgccggcgggatggaatcgatgagcaac
gccccgtatgtgcttccgaaagcgcgctgggggctgcggatgggcgacagcacggtgaaa
gatttaatggtgtatgacggcctcacgtgcagcttcactggcgttcatatgggcgtctac
ggcgggaatacggcgaaagagctcggcattacgagggaggcgcaagacgagtgggcgtac
cgcagccatatgcgcgccattgccgccatcgaagccgggcggctggcggaagaaatcgtg
ccggtttcgattccgcagcgcaaaggtgagccgcttgtcgttgaacgcgacgaggcgccg
cgcaaagatacgtcgcttgaagcgttggcgaaactgaaaccggtgtttgaccccgaaggc
acgatcacggccgggaacgccccaggcgtcaacgatggcgctgccgcgcttgtgttgatg
agccaggagcgcgccgcccgcgaggggctcgagccgctggcgacggtcgtcgcccacacg
gccatcgccgtcgaggcgaaagatttcccgaaaacgccggggcttgtcatcaacgaactg
ctccgcaaaacaggaaagaccgttgacgacattgacttgttcgaagtgaacgaagcgttt
gccgcggttgcgcttgccgccattcaaatcgccgggcttgatccggaaaaagtaaacgtc
aacggcggcgctgtcgccctcggtcatccgatcggcgcgagcggggcgcgcatcatcttg
acgctcgcccatgagttgaagcgccgcggcggagggctgggcattgccgcgatttgcagc
ggcggcggtcaaggcgacgccatcttaatcgaagtataa

DBGET integrated database retrieval system