KEGG   Geobacter sp. M18: GM18_0288Help
Entry
GM18_0288         CDS       T01421                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
geb  Geobacter sp. M18
Pathway
geb00020  Citrate cycle (TCA cycle)
geb00640  Propanoate metabolism
geb00660  C5-Branched dibasic acid metabolism
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01120  Microbial metabolism in diverse environments
geb01130  Biosynthesis of antibiotics
geb01200  Carbon metabolism
Module
geb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
geb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GM18_0288
   00640 Propanoate metabolism
    GM18_0288
   00660 C5-Branched dibasic acid metabolism
    GM18_0288
Enzymes [BR:geb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GM18_0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ADW11777
UniProt: E8WMR7
Position
complement(350075..351232)
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQAKEILNSFGIPIPRGRVALTADQVERAAKEMGGRCVVKAQIYAGGRGKAGGVK
LVHHPEQAQEYAKELFGRTLVTPQTGPEGLKVRRILVEEAVEIAREFYLSITLDRSTSRY
VLIASAEGGMEIEEVASKSPEKIHTLTIDPFLGLRSYQARHIALQLGLTGSVCEDCVNLI
QNLYRVCLDKDCALVEINPLVITRAGWLMAMDAKITFDDNAIFRHREYPDMMDYSQLDPL
EINAGKYDLAYIKLSGSIGCLVNGAGLAMATLDVLKEYGGEPANFLDVGGGATREKVAEA
FKIILQDSDVKGIFVNIFGGIMRCDVIAHGIIEAASEVNCTLPIVVRMDGSQVEEGKRLL
TESGLNVQCSDNLGDAASKIVGMLG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgagtatcaagccaaggagatactgaactcgttcggcatccccatcccc
cgtggccgcgtggccctcacggccgaccaggtggaacgggcggccaaagagatgggaggg
cgctgtgtcgtcaaggcccagatctatgccggcggacgcggcaaggcaggcggcgtgaag
ctggtgcatcacccggaacaggcccaggagtatgccaaggagctgttcggcagaaccctt
gtcacaccgcagaccggcccggaggggctcaaggtgcggcgcatcctggtcgaggaagcg
gtcgagatcgcccgcgagttttatctctcgatcaccctggaccggagcacgtcgcgctac
gtcctgatcgcctccgcggagggggggatggaaatcgaggaagtcgccagcaagagcccg
gagaagatccacacgctcaccatcgatcccttcctggggctcagatcataccaggcacgc
catatcgccctgcaactggggctcaccggaagcgtctgcgaggactgcgtcaacctgatc
cagaacctgtaccgggtctgtctcgataaggactgcgcgctggtcgagatcaacccgctg
gtgatcaccagggccggctggctcatggcgatggacgcgaagatcaccttcgacgacaac
gccatcttcaggcaccgcgaataccccgacatgatggactactcccagctcgaccctctg
gaaatcaacgccggaaagtacgacctggcctacatcaagctctccggctccatcggctgc
ctggtgaacggcgccggcctggccatggccaccctggacgtgctcaaggagtacggcggc
gagccggccaacttcctggatgtcggcggcggcgccacccgcgagaaggttgccgaggcc
ttcaagatcatcctgcaggactccgacgtaaaggggatcttcgtcaacatcttcggcggc
atcatgcgctgcgacgtgatcgcccacggcatcatcgaggcggcgagcgaggtgaactgc
acccttcccatcgtggtccgcatggacggcagccaggtcgaggaggggaaacggctcctc
accgagagcggcctgaacgtccagtgcagcgacaacctgggagacgcggcctcgaagatc
gtagggatgctggggtag

DBGET integrated database retrieval system