KEGG   Geobacter sp. M18: GM18_1705Help
Entry
GM18_1705         CDS       T01421                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
geb  Geobacter sp. M18
Pathway
geb00220  Arginine biosynthesis
geb00330  Arginine and proline metabolism
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01130  Biosynthesis of antibiotics
geb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    GM18_1705
   00330 Arginine and proline metabolism
    GM18_1705
Enzymes [BR:geb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     GM18_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase DUF87
Motif
Other DBs
NCBI-ProteinID: ADW13169
UniProt: E8WTS6
Position
2062493..2063383
Genome map
AA seq 296 aa AA seqDB search
MENGIRMIGVPVDLGQEQRGVDLGPGALRYAGLSARLSQLGYLVEDIGNLPVPVRDVLGA
ERELRYLPSIRQVCETVYQAGRSAVAQGAMPIFMGGDHSMAIGSIGGVTDEQPTAVIWVD
AHGDYNTPDSTITGNIHGMALAALLGEGFPELVNVGRPGAKLHAADIVLIGLRELDPQEK
LRLRGSGIKAYTMRDIDERGMAAIAREALGRLAHRTRLHVSLDLDGLDPLEVPGVGTTAP
GGITYREAQLLMEIIADSGLLRSMDIVEINPILDHSNRTAKIAVELTASAFGASIL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacggcatcaggatgataggagtcccggtcgatctcgggcaggagcagcgcggc
gtcgacctcggcccgggcgccctgcgctacgcggggctgtcggcgcggctctcccagctt
ggctacctggtcgaggatatcggcaacctgccggttccggtgcgtgacgtgctgggcgcc
gagcgggaactccgctacctcccctcgatccggcaggtgtgcgagacggtctaccaggcg
gggcggagcgccgtagcccagggggccatgcccatcttcatgggtggggaccattccatg
gcgatcggctccatcggcggggtgaccgacgagcagccgaccgcggtgatctgggtcgat
gcccacggggactacaacaccccggacagcaccatcaccggcaacatccacggcatggcg
ctggcggccctgttgggggaggggttccccgaactggtcaacgtcgggcgtcccggggcc
aagctgcacgcagctgacatcgtgctgatcggcctgcgggagctcgatccccaggagaag
ctccgtctgcgcggcagcggcatcaaggcctacaccatgcgggacatcgacgagcgcggc
atggcggccatcgcccgcgaggcgctggggcggcttgcccatcgcacacggctgcacgtg
agcctcgacctggacgggttggacccgctcgaggtgccgggggtggggaccacagctccg
ggcggtatcacctatcgcgaggcgcagctgttgatggagatcattgccgacagcgggctg
ttgcggtcgatggacatcgtcgagatcaaccccatcctggaccacagcaaccggaccgcg
aagatagcggtcgagttgactgcctcggccttcggggcgtcgatcctataa

DBGET integrated database retrieval system