KEGG   Geobacter sp. M18: GM18_1891Help
Entry
GM18_1891         CDS       T01421                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
geb  Geobacter sp. M18
Pathway
geb00010  Glycolysis / Gluconeogenesis
geb00051  Fructose and mannose metabolism
geb00562  Inositol phosphate metabolism
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01120  Microbial metabolism in diverse environments
geb01130  Biosynthesis of antibiotics
geb01200  Carbon metabolism
geb01230  Biosynthesis of amino acids
Module
geb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM18_1891
   00051 Fructose and mannose metabolism
    GM18_1891
   00562 Inositol phosphate metabolism
    GM18_1891
Enzymes [BR:geb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GM18_1891
Exosome [BR:geb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GM18_1891
  Exosomal proteins of bladder cancer cells
   GM18_1891
  Exosomal proteins of melanoma cells
   GM18_1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: ADW13354
UniProt: E8WI53
Position
complement(2279955..2280710)
Genome map
AA seq 251 aa AA seqDB search
MRKPVIAGNWKLYKTKDEALALIEELAPLVAGVSNVEIVVAPVFTVLPTLPAALAGTSIS
LAAQDVFWEEEGAFTGEVSPRMLLDAGASHVIIGHSERRQYFGETDETVNKKIKAALKGA
LVPIFCIGETLEAREAGETFKVLERQVKGGLEGLTETQFAPVIIAYEPVWAIGTGKVATD
EQAQEAHAFIRGVVAKLFSQSAADKVRILYGGSVKPENAKGLMACADIDGALVGGASLKG
ASFASIVRFGE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaccggtcatagcaggtaactggaaactgtacaagacgaaggacgaggcgctg
gcactgatcgaggaactggccccgctggtcgcaggggtcagcaacgtggagatcgtggtg
gcaccggtgttcaccgtgctccccaccctccccgcagcactcgccggcaccagcatcagc
ctcgccgcccaggacgtcttctgggaggaggaaggtgccttcacgggtgaggtatccccg
cgcatgctgctcgacgccggcgcaagccacgtcatcatcgggcactccgagcgcaggcag
tacttcggcgaaacggacgagacggtgaacaagaagatcaaggcggccctcaagggggca
ctggtccctatcttctgcatcggcgagaccctggaggcacgcgaggcgggagagacgttc
aaggtgctggagcgccaggtgaagggaggcctggaggggctgaccgagacccagtttgca
ccggtcatcattgcctatgagccggtctgggccatcggcaccgggaaggtagccaccgac
gagcaggcccaggaggcccacgccttcatccgcggcgtcgtggccaaactgttcagccag
agcgccgcagacaaggtcaggatactgtacggcgggtcggtgaaacccgagaatgcgaaa
gggctgatggcctgcgctgacatagacggagccctggtggggggagcgagtctcaagggc
gcctcttttgcctcaatcgtccgtttcggcgaataa

DBGET integrated database retrieval system