KEGG   Geobacter sp. M18: GM18_2086Help
Entry
GM18_2086         CDS       T01421                                 

Definition
(GenBank) Propanoyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
geb  Geobacter sp. M18
Pathway
geb00071  Fatty acid degradation
geb00280  Valine, leucine and isoleucine degradation
geb00310  Lysine degradation
geb00362  Benzoate degradation
geb00380  Tryptophan metabolism
geb00620  Pyruvate metabolism
geb00630  Glyoxylate and dicarboxylate metabolism
geb00640  Propanoate metabolism
geb00650  Butanoate metabolism
geb00900  Terpenoid backbone biosynthesis
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01120  Microbial metabolism in diverse environments
geb01130  Biosynthesis of antibiotics
geb01200  Carbon metabolism
geb01212  Fatty acid metabolism
geb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:geb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GM18_2086
   00630 Glyoxylate and dicarboxylate metabolism
    GM18_2086
   00640 Propanoate metabolism
    GM18_2086
   00650 Butanoate metabolism
    GM18_2086
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GM18_2086
   00072 Synthesis and degradation of ketone bodies
    GM18_2086
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GM18_2086
   00310 Lysine degradation
    GM18_2086
   00380 Tryptophan metabolism
    GM18_2086
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GM18_2086
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GM18_2086
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GM18_2086
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:geb04147]
    GM18_2086
Enzymes [BR:geb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GM18_2086
Exosome [BR:geb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GM18_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ADW13549
UniProt: E8WJN9
Position
2498966..2500258
Genome map
AA seq 430 aa AA seqDB search
MRPVYMISGGITKFAKALPQTDFRRMVKDAFDYALADLPGLSRDQIDGSVCSCFSDHFTR
QLMAGAMVQDYLGLNPKPSRRVEGGGATGGLCFQSAWESVASGRMEVCLAMGFETMGRVN
TWKGNEFIALASDTNFDYPVGGFYTGYYAMMVNRHMHEFGTTVEQMAKVAIKNHLNAVYN
PYAQRPGRLTIEDVRTALMVAEPLTILDCCQMSDGAAVAILASEEMAQKLGGTPVRVTGV
GSGTDAMRMADRPQGEVMLLPHETREEYADLKYPGVHSFRGGRMAAKNAYRMAGINDPGQ
ELDFVELHDAYTSSEIQTCEDLGLCRYGEGGSFVDSGAPFMPNLHYGLTFSGSEKWRPLP
VNPSGGLLACGHPVGATGLMQAVFAFWQLQGTIEKHLKDATLQLPDPRRGLIHSHAGTGT
YITVSIMERV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgtctacatgatatcggggggaatcaccaagttcgccaaggcgctcccccag
accgatttccgccgcatggtgaaggacgccttcgattacgccctggccgatcttccgggc
ttgagccgcgaccagatcgacggcagcgtctgttcctgcttctcggaccatttcaccaga
cagctcatggcgggggcgatggtgcaagactacctggggctgaaccccaagccgtcgcgc
cgggtcgagggaggaggagcgacggggggactctgtttccagtcggcctgggagtcggtc
gcctccggccgcatggaggtctgcctcgccatggggttcgagaccatgggccgggtcaac
acctggaaggggaacgagttcatagcactcgcctccgacaccaacttcgactatcccgtg
ggaggtttctacacaggctattacgccatgatggtgaaccgccacatgcacgagttcggg
accacggtggagcagatggcgaaggtcgccatcaagaaccatctgaatgcggtctacaat
ccctacgcgcagcggccggggaggctcaccatagaagacgtccgcacggcactgatggtt
gccgagcctctgaccatcctggactgctgccagatgtccgacggggccgccgttgcgatc
cttgcttctgaggaaatggcccagaaattgggcgggacgccggtgcgggtgaccggagtc
gggagcggcacagatgccatgcgcatggccgaccgcccccagggcgaggtgatgcttttg
ccccacgaaacacgcgaagagtacgcggatctgaagtatccgggcgtgcactcgttccgc
ggggggcgcatggctgccaagaacgcctaccgcatggccggaatcaacgatcccgggcag
gagctcgacttcgtggagctgcacgacgcctacacctcctccgagatccagacctgcgag
gatcttggcctgtgccgctatggagaggggggcagtttcgtggattccggggctcccttc
atgcccaacctccattacggcctgaccttttcggggtccgagaagtggcgtccgctcccg
gtgaacccctccggagggcttctcgcctgcggtcatcccgtgggcgccaccgggctcatg
caggccgtttttgccttctggcaattgcaggggaccatcgagaagcatctgaaggatgcc
accctgcagcttcccgatccgcggcgcgggctgattcacagccatgccgggaccggaacc
tacatcaccgtatcgatcatggagagggtgtga

DBGET integrated database retrieval system