KEGG   Geobacter sp. M18: GM18_2306Help
Entry
GM18_2306         CDS       T01421                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
geb  Geobacter sp. M18
Pathway
geb00010  Glycolysis / Gluconeogenesis
geb00030  Pentose phosphate pathway
geb00051  Fructose and mannose metabolism
geb00052  Galactose metabolism
geb00680  Methane metabolism
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01120  Microbial metabolism in diverse environments
geb01130  Biosynthesis of antibiotics
geb01200  Carbon metabolism
geb01230  Biosynthesis of amino acids
geb03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM18_2306
   00030 Pentose phosphate pathway
    GM18_2306
   00051 Fructose and mannose metabolism
    GM18_2306
   00052 Galactose metabolism
    GM18_2306
  Energy metabolism
   00680 Methane metabolism
    GM18_2306
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GM18_2306
Enzymes [BR:geb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GM18_2306
Protein phosphatases and associated proteins [BR:geb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GM18_2306
Messenger RNA biogenesis [BR:geb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GM18_2306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADW13765
UniProt: E8WMF5
Position
2783594..2784553
Genome map
AA seq 319 aa AA seqDB search
MKKIGILTSGGDCSGMNAAIRSATRTALGHGVQVLGFRKGYAGLLKGDFLEMASKDVAGI
LHRGGTFLQSARSEEFRTVLGREKAVRHLQDFGVEGLIVIGGDGSLNGALALHRMGVPVI
GIPASIDNDIAYTDMALGVDTALNNIIYAVDCIKDTASSHDRAFVIEVMGRNSGYLASMS
AIATGAEYAIVPEVECDIADLCNQLRKRYEEGRSNAIIILAEGAGRAQNIADNIKDAIGF
ETRVTVLGHYQRGGAPSVFDRLLGSRFGHAAAEQLLAGEKGKMVGLCCNELCLTALETVV
VSEKPQQDELHELSMVLGI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagataggtattctcaccagcggcggggactgctccggcatgaacgcggccatc
aggagcgcgacccgaaccgcactcggacacggggtgcaggtgctgggtttcaggaaaggg
tacgccggcctgttgaagggtgacttcctggagatggcgagcaaggacgtggcggggatt
ctgcaccgcggcggcaccttcctgcagtcggccaggagcgaggagttccgcaccgtgctc
gggcgcgagaaggcggtgcgccacctgcaggatttcggggtcgaggggctcatcgtgatc
ggcggcgacggctcgctaaacggcgccctggcgctgcaccgcatgggggtcccggtgatc
gggatcccggccagcatcgacaacgacatcgcctacaccgacatggccctcggcgtcgac
accgcgctcaacaacatcatctacgccgtggactgcatcaaggacaccgcgagctcgcac
gaccgcgccttcgtcatcgaggtgatggggagaaactccggatacctcgccagcatgagc
gccatcgccaccggcgccgagtatgccatcgtcccagaggtcgagtgcgacatagcggat
ctgtgcaaccagctcaggaaacgctacgaggaggggcgcagcaacgccatcatcatcctc
gccgaaggggccgggcgggcgcagaatatcgccgacaacatcaaggacgccatcggcttc
gagacccgcgtgaccgtgctcgggcactaccagcgcggcggtgccccttccgtcttcgac
cggctcctgggaagccgcttcggccacgcggcggcggagcagctcctggcgggcgaaaag
gggaagatggtggggctttgctgcaacgagctctgccttacggcgctggaaacggtggtg
gtgagcgagaaaccccagcaggacgagttgcacgaactctccatggttctcgggatctga

DBGET integrated database retrieval system