KEGG   Geobacter sp. M18: GM18_2734Help
Entry
GM18_2734         CDS       T01421                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
geb  Geobacter sp. M18
Pathway
geb00500  Starch and sucrose metabolism
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
Module
geb_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GM18_2734
Enzymes [BR:geb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GM18_2734
Exosome [BR:geb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GM18_2734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_48 Alpha-amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: ADW14183
UniProt: E8WSC1
Position
complement(3255353..3257167)
Genome map
AA seq 604 aa AA seqDB search
MSKETNIKEKELKGKRSEGMGATPHTGGVGFRVWAPHATRVSVIGAFNDWDGAKNPLQAE
ENGNWYADVPGAKIGDPYKFLLTTEKGEFKRIDPYAREVTGSTGDAVVHDPSFDWGDDFH
LAPWNELVIYELHAGTFNDQEDDNAAAQFDSIAARLGHLKKLGVNAIQIMPVGEFAGDRS
WGYNPAHIFSVELSYGGPLAFKRFVKRAHSQGIAVILDVVYNHLGPSDLDLWQFDGWSEN
GLGGIYFYNDGRSHTPWGETRPNYGVGEVRQFISDNVFMWLQEYHVDGLRYDCTQFIRSI
DGAVENDLPEGWSLLQWLNEQVAQQFPGRIIIAEDLQNNNWLTKSVGAGGAGFGSQWDAH
FVHPIRQAVITPDDQERSLSAVRDALCYRYNDDAFDRVIYSESHDEVANGKARVPQEINP
GDPKGWFAQKRSTLAAALVFTAPGIPMLFQGQEFLEGEWFRDTVPLDWDQRDEFRGIVRL
YRDLIHLRLNRAGFTRGLCGQFTQVHHLNEEAKVIAFHRWDQGGAGDDVVVVANFLGEPQ
EGYVVGFPAEGTWKLRFNSDWQGYSEAFADHPSSDASAETGECDGLPCHAAISLGPYSVL
IFSQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagagaccaatatcaaggagaaagagctcaaggggaaaaggagcgaggggatg
ggggcgaccccgcacacggggggagtcgggttccgcgtctgggccccgcatgcaacgcgg
gtatcggtcatcggggcgtttaatgactgggacggcgccaagaacccgctgcaggccgag
gagaatggcaactggtatgccgatgtgccgggggccaaaatcggcgatccctacaagttc
ctgctcactaccgaaaagggcgagttcaagcgcatcgacccctacgcccgcgaggtgacc
ggttcgaccggcgacgcagtggtccacgatccgagctttgactggggcgacgactttcac
ctggctccctggaacgagttggtcatctacgagttgcatgccgggactttcaacgaccag
gaggatgacaacgcggccgcccagttcgactcgatcgcggcccgcctcggacatctgaaa
aagctcggcgtcaacgccatccagatcatgccggtgggcgagtttgccggcgaccggtcc
tggggttacaaccccgcccatatcttctccgtcgaactgagctacggagggcccctggcc
ttcaagcgtttcgtcaaacgcgcccacagccaagggatcgcggtgatcctcgacgtggtc
tacaaccacctgggcccaagcgacctcgatctgtggcagttcgacggctggtccgagaac
gggctgggcggcatctacttctacaacgacggccggtcccacaccccctggggggagacc
cgccccaattacggcgtgggcgaggtgcgccagttcatatccgacaatgtgttcatgtgg
cttcaggaataccacgtggacgggttgcgctacgactgcacccagttcatcaggagtatc
gacggggcagtcgaaaacgaccttcccgaggggtggagtctcctgcagtggctgaacgaa
caggtcgcccagcagttccccggccgcatcatcatcgccgaggacctgcagaacaacaac
tggctcaccaagtccgtgggtgccgggggcgccggcttcggatcacagtgggacgcccac
ttcgtgcatcccatacgccaggcggtgataacccccgacgaccaagagcgctcgctttcc
gccgtccgcgacgccctttgttaccgctacaacgacgacgccttcgatcgggtcatctac
agcgaaagtcacgacgaggtggccaacggcaaggctcgcgtgccgcaggagataaacccc
ggggaccccaagggatggttcgcccagaaacgctcgaccctggccgccgccctggtcttc
acggctcccggcataccgatgctgttccaggggcaggagtttctcgaaggggagtggttc
cgggacacggtcccgctggactgggatcagcgcgacgagttccgcggcatcgtccggctc
taccgggacctgatccatctgcggctcaaccgcgctggtttcacccgcggcctgtgcggg
cagttcacccaggtgcatcacttgaacgaggaggccaaggtcatcgccttccaccgctgg
gaccagggtggagcgggggacgacgtcgttgtggtcgccaatttcctcggagagccgcag
gagggctacgttgtcggcttcccggccgaagggacctggaagctgcgcttcaacagcgat
tggcagggctacagcgaagccttcgctgaccatccgagcagcgacgccagtgccgaaacg
ggcgagtgcgacggcctcccctgtcacgccgcaatttccctgggaccctacagcgtgctg
atcttttcccagtga

DBGET integrated database retrieval system