KEGG   Geobacter sp. M18: GM18_2899Help
Entry
GM18_2899         CDS       T01421                                 

Definition
(GenBank) phospholipase C zinc-binding protein
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
geb  Geobacter sp. M18
Pathway
geb00562  Inositol phosphate metabolism
geb00564  Glycerophospholipid metabolism
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:geb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GM18_2899
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GM18_2899
   00565 Ether lipid metabolism
    GM18_2899
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GM18_2899
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:geb02042]
    GM18_2899
Enzymes [BR:geb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     GM18_2899
Bacterial toxins [BR:geb02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   GM18_2899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_dep_PLPC PetG
Motif
Other DBs
NCBI-ProteinID: ADW14343
UniProt: E8WU08
Position
complement(3458127..3458939)
Genome map
AA seq 270 aa AA seqDB search
MNKVCISVLGMILITILGFDFANAWSNGQSGNTTTNTPSECPNPPYGTHDWIADHALSML
PDHEKFWLENNKLYYLLGTEAPDNNEIPQDCGTPNPGYDDRNRGHSVEWSDDWSKMLNDR
AAARAKEEYYKAAKAYKNKDYKAAAFFLGAMAHYVGDVSAYPHSVPYEKYHSRYENWVNK
DTDSFNTGKYEVFVKLDNLVKRTPYEAVKRISKMTAGGKGKILNPVEMENLFEEDKNSAA
LIQSVGLSLNGGVNELADVLHTFYVNEVNK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtctgtatatctgttttaggaatgatcttaatcactatactaggattcgac
ttcgctaatgcatggtcaaatggtcaatcaggaaacaccacgacaaatacaccctccgaa
tgtcctaacccaccatatggtacacatgattggattgctgaccatgctctgtcaatgctt
cccgatcatgaaaaattttggttggaaaataacaagctatattacttattgggcaccgag
gctcctgacaacaacgaaattccacaagattgcggcactcccaatccagggtacgatgac
cgaaatagagggcatagtgttgaatggtcagatgattggtcaaagatgttgaatgaccgc
gcggcagctagggctaaggaagagtactataaagcagcaaaggcatataaaaataaggat
tataaggcagcagcctttttcttgggcgctatggcgcattatgttggtgatgtctctgcc
tacccccattctgtcccttacgaaaagtatcatagcagatatgaaaattgggttaacaaa
gatactgattcatttaatactggtaagtacgaggtttttgttaaattggacaatttagtg
aaaagaactccttatgaagcagtaaagcgcatatcaaaaatgacggctggaggaaaaggc
aaaatacttaatcctgtcgaaatggaaaatctatttgaagaagataagaactcagcagca
cttattcagagtgtgggattgtccttaaatggcggagtaaatgaattggcagatgttctt
cataccttctatgtaaatgaggtgaataaatag

DBGET integrated database retrieval system