KEGG   Geobacter sp. M18: GM18_3028
Entry
GM18_3028         CDS       T01421                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11897  type VI secretion system protein ImpF
Organism
geb  Geobacter sp. M18
Brite
KEGG Orthology (KO) [BR:geb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:geb02044]
    GM18_3028
Secretion system [BR:geb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GM18_3028
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ADW14471
UniProt: E8WHS1
Position
complement(3592639..3593109)
AA seq 156 aa
MRLHPQLRGSLLDRLTDDAPEAAVEPVQSQSAGFNSMIRSVLRDLENLLNTRSLAGGAPL
PAGETARSILAYGSRDFSSANPRSQEVRQQIRLEILTLLTRFEPRLKDARVRLDPIRREG
RLNFRIEAVLQVEPVSVPTVFDTCFDMNSGSYTIHT
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcgactccatccgcaactgagaggatcgctgctggacaggctcacggacgatgcgccg
gaagcggccgtcgagcctgtccagtcgcaaagtgccggcttcaactccatgatccggtcc
gtattgcgcgacctggaaaatctcctcaacacgagatcgttggcagggggcgcgccgctg
cccgccggagagacggcacggtccatcctggcctatggcagtcgggacttcagctcggcg
aacccgcgctcgcaggaggtcaggcagcagatacggctggaaatactgacacttctgacc
cggttcgagccccggctgaaggatgccagggtaaggcttgacccaatccggagagagggc
cgcctcaacttccggatcgaggccgtcctgcaggtcgagccggttagcgtccccaccgtc
tttgatacctgcttcgatatgaacagcggttcttacaccatccatacgtga

DBGET integrated database retrieval system