KEGG   Geobacter sp. M18: GM18_3032
Entry
GM18_3032         CDS       T01421                                 

Definition
(GenBank) type VI secretion-associated protein, ImpA family
  KO
K11902  type VI secretion system protein ImpA
Organism
geb  Geobacter sp. M18
Brite
KEGG Orthology (KO) [BR:geb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:geb02044]
    GM18_3032
Secretion system [BR:geb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GM18_3032
SSDB
Motif
Pfam: ImpA_N T6SS_VasJ TPR_19 TPR_4
Other DBs
NCBI-ProteinID: ADW14475
UniProt: E8WHS5
Position
complement(3595702..3597033)
AA seq 443 aa
MIRDICVDELLLPISEETPAGSDLRYTTIYEEIMEARRCEDAIAMGDWQHEVKKANWDKA
ISLAVSALGTKSKDLQIAAWLTEAITVTEGFSGLDLGLQLVMGLAERFWETVYPLSEEGD
LEYRATPFQFLNEKISLQVRRIPLTDPEATPGYTWLKWQQSREVGSEADLKNRYGEIDED
KKIRRDELLAESALSAEDFDAAVARSKGAYAGEIREQVARCRQSLNRLAEVLEAKFLNCA
PSLAELASVVDGCSALLESLYGQKPTVEEDMAAAGAPGRSEAGEIKGTGAAQPDGIAPPT
ERDLPAAASVAAGPGLPERTLWGDALAMLEAGRLQEALAMLLYTSNRSDSVRDRNRGRLL
MGKLCLQAGRPDLARPIIEELHRVIEELKLELWESPLWIAEVLEAYYQCLQAGGPRECDL
DLAQTLFRRICSLDITKAMPYRT
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgatccgggacatatgcgtcgacgagctgttgcttccgatctcggaagaaacccccgct
ggaagcgacctccgctacacgaccatttacgaggagatcatggaagcgcgtcgctgcgag
gatgccatcgccatgggagactggcagcacgaggtcaagaaggccaactgggacaaggcc
atctcgcttgccgtcagcgccctcggcaccaaaagcaaggacctgcagatagccgcatgg
ctcaccgaggccatcacggtgaccgaagggttcagcggtctcgatctcgggctgcaactg
gtcatggggcttgccgagcgcttctgggagacggtttacccgcttagcgaggagggggac
ctggaatatcgggccaccccctttcaattcctgaacgagaagatctccctgcaggtcagg
cggatcccgcttaccgatccggaagccactcccggctacacctggcttaagtggcagcag
tcccgtgaagtcggctccgaagccgacctgaagaaccgctatggcgagatagacgaggac
aaaaagatcaggcgtgatgaactgctagccgagtcggccttgagcgccgaagactttgat
gccgccgtggcgcgatccaaaggggcctatgccggcgaaatccgcgagcaggttgccagg
tgccggcaaagtctcaatcgattggcagaggtactggaggcaaagttcctcaactgcgca
ccgagccttgccgagcttgcctcggtcgtcgatggctgcagcgcgttgctggaaagcctc
tatggccaaaagccgacggttgaagaagatatggcagcagcaggcgcaccggggcgatcg
gaagcaggagagatcaaggggacgggggcggcgcagcccgatggaattgcgcctcctacc
gagcgcgatcttccggcggccgcctcggttgccgccggcccggggctgccggagcgcacc
ctttggggagatgcccttgccatgctggaggcggggcggctgcaggaggcgctggccatg
ttgctgtacaccagcaaccgctctgattcggtgcgcgatcgcaacagggggaggcttttg
atgggtaagctctgtctgcaggcggggaggccggatctggctcgacccataatcgaggaa
ctgcaccgcgttatagaggagctgaagctggagctctgggagtcccccctttggatcgcc
gaggtgctggaggcctactatcagtgcctgcaggcggggggaccccgggaatgcgatctc
gacttggcgcagacgctgttcaggcgcatctgttcactagacatcacgaaggcgatgccg
tatcgcacctag

DBGET integrated database retrieval system