KEGG   Geobacter sp. M18: GM18_3033Help
Entry
GM18_3033         CDS       T01421                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
geb  Geobacter sp. M18
Pathway
geb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:geb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GM18_3033
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:geb02044]
    GM18_3033
Secretion system [BR:geb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GM18_3033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF_C IcmF-related AAA_16 DUF4131
Motif
Other DBs
NCBI-ProteinID: ADW14476
UniProt: E8WHS6
Position
complement(3597030..3600479)
Genome map
AA seq 1149 aa AA seqDB search
MKQNVLTYCKYALFGAALFPTLVIAFVMIQLLPWPWRVGIFLPFIVLLLWGVLESLKKLL
RKNADKPQPVRQEPVAVEPQLAEPMRQDRLHDLQQSWRTAVRVLKTSHLKKEGDPLHVLP
WYLVLGASGSGKTSAVRGARLLSPFAQGQGETTATANCDWHFYDEGIVIDTAGRYAVPLD
PGSDHEEWRTFLSLLKKYRRTELINGVILTVSADRLAGGDSQELEDQGRQLRCRMDEMIR
FLGINFPAYLLITKCDLISGMSEFCALLPPESLDQPMGLLNQELDREAPRFLDRLSAFVD
ERLRMLRLLLLHRGSATPPGGRLLLFPDRLRALRPGLDLFMQAAFAENHYQETPLLRGIY
LCSARRPTPTQAAVQDRVVAPGGGHVAAAAHGVFIHDFFEKVLPRDRGLWTPSARTLKWR
HLSGNLALVCWLLLGTSLCVLLTCAFAKNMTVMREAAVLSVVAPQLQGDVAVDLPALEKM
RRAILDLEHENRNWWTPRFGLTRSMEVEQTLKARYCTAYQKHLLAPFDGRMAAPLEALSP
AIPDQAFGALVLHLSRRCNLLKARRAGDDLAALSARPLPQYQVLASQPEEWSNPVCGSLY
LCYVAWRTDTGELSRELQRLQSLLKRLVQLKGANLTWLIGYVDREQATAAISLQDFWSGS
RPLSGEPTVAPSFTRRGRERIASLLEELCAAYPDRGVLERERGEFLRGYREVTFAAWRHF
AAQLPKGEQRLIAPGEWQSAAAGMAGEQGPYFSFMRRALSELQPFDTAEPLPAWIAELYR
FQALKRGGPAGVASSLSRQASRLAGTIGGLGGKKESLAGSDPGVNLAREYLNAVAQIAPV
AKSRASAHRMALQAFSDSGEAGKSPLFLAAETAQRLNRLLAQGQGDDTFARLIYGPISFY
GTYIRMETACTLQAQWEQRVLKEVQGSSDAQTLQYLLGKDGPVWKYVGDYANPFIGWSPA
RGYYPKSALGGSIPFKPEFYSFLAQGGRAKLAAAAGAPKPVYQVTIKGLPTDANAEALKP
QGTRLELHCATGPQVIANMNYPVSKPFIWTPETCSDVVLQIEIGDTVLTRRYPGSSGFAD
FLRDFPAGRHTFHPRNFPHEKEALERMGVRFIKVNYQMSGAGDITSKQAESLPARIPVKI
AECWDQGEP
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaaaacgtgctcacctattgcaaatacgcgctgttcggcgcggcgcttttcccg
acgctggtgatcgccttcgtgatgatccagctcctgccctggccctggcgcgtaggcatc
ttcctccctttcatcgtgctgctgctttggggggtgcttgaatcgctcaagaagctgctt
cggaaaaacgctgacaagccgcaaccggtgcggcaggaaccggttgcggtggaaccgcag
cttgcggagccgatgcgacaggatcggctccacgatctgcagcagagctggcggacggcg
gtccgcgtgttgaagacgtcgcatctcaaaaaggagggggacccgctgcacgtcctcccg
tggtacctggtgctgggtgcgagcggttcgggtaagacctctgcggtgcggggcgcccgc
ctcctgtcaccttttgcgcagggacaaggcgagacgacggcgacagcaaactgcgattgg
cacttctatgacgaggggatcgtgatcgacacggcggggcgctacgccgtgccgctggac
cccggctccgaccacgaggagtggcgcacctttctctccctgctgaagaaataccgcagg
accgagttgatcaacggcgtcatccttacggtgtcggccgaccggctcgccggcggcgac
tcgcaggaactggaggaccaggggcggcagctgcgctgccgcatggacgagatgatccgc
tttctcggcatcaactttcctgcctacctgctcatcaccaagtgtgatctcatcagcggc
atgagcgagttctgcgccctgctcccccctgagagcctcgaccagccgatggggcttttg
aaccaggagctggaccgggaagcgccgcgctttctcgatcgtctttcggcctttgttgat
gagcggttgaggatgctgcgccttttgctgctgcatcgcggttcagccacgccaccgggc
gggcgcctgctgctcttccccgatcgactgagggcgctgcgccccggcctcgacctcttc
atgcaggccgcgtttgccgagaaccattaccaggagaccccgcttttgcgcggcatctac
ctgtgcagcgcccgtcggccgaccccgacgcaggcagctgtgcaagaccgcgtcgtcgct
ccaggcggggggcacgttgccgctgcggctcacggtgttttcatccacgatttcttcgag
aaggtcctgccgcgagaccgcgggctttggacccccagcgcccggaccctcaagtggcgg
cacctctccggcaaccttgccctggtctgctggctcctgctcgggacctcgctctgcgtt
ctgctcacctgcgcgttcgcgaagaacatgacggtgatgcgggaagcggctgtgctttcc
gtcgttgcgccgcaactgcaaggggatgtggcggtcgatcttcccgccctggaaaagatg
cgccgcgccatcctcgacctggagcatgagaaccggaactggtggacgccccggtttggg
ctgacccgcagcatggaggtggagcagaccctgaaggcgcgctattgcactgcataccaa
aagcacctgctggctccgttcgacggcagaatggcagcccccctcgaagcgctctccccc
gccataccggaccaggctttcggggctttggtcctgcacctgagccggcgctgcaacctt
cttaaagcgcgccgggccggagatgatctcgctgcgctctccgcgcgcccccttccgcaa
taccaggtgctggcatcccagcctgaggagtggtcgaatcccgtctgcggaagcctttat
ctctgctatgtcgcctggcgtaccgataccggcgagctgtcccgggaattgcagcggctg
caatcgttgctgaagcgccttgtccaactgaagggggcgaatctgacctggctgatcggt
tacgtcgaccgggagcaagccacagccgccatctcgctgcaggatttttggagcggctca
cggccgttgtcgggcgagcccacagttgcgccatcgttcacccgcaggggaagggagcgc
atcgcctccttgcttgaggagctgtgcgcggcgtacccggaccggggcgtcctggagcgg
gagaggggggagttcctgcgcgggtaccgcgaggtcacctttgccgcctggcggcatttt
gcggcacagttgccaaagggggagcagcggcttatcgcccccggggagtggcaaagtgcg
gcggccggcatggcgggggagcaggggccatacttcagcttcatgcgccgcgccctgtca
gagctgcaaccgttcgacacagcagagcccttgccggcatggatcgccgaactataccgc
ttccaggcgctgaagaggggaggtccggcaggcgtcgcctcctcgctttcgcggcaggcc
agccggttggccgggaccatcggggggctcgggggcaaaaaggagagcctcgccggcagc
gatcccggtgtgaacctggccagagagtacctgaacgccgtggcgcagatagcgccggtg
gcgaaatcaagggcatcggcacaccggatggcgctgcaggccttcagcgactccggcgaa
gccggcaagtccccccttttcctggcggctgagaccgcacagaggctgaaccggctcctg
gcgcagggacagggggacgatacctttgcccgtctcatctacggccccataagcttctac
ggcacctacatccgcatggagaccgcctgcacgcttcaggcgcagtgggaacaaagggtg
ctgaaggaggtgcaggggagcagcgacgcacagaccctgcagtatctgctgggcaaggac
ggaccggtctggaagtacgtcggcgactacgccaacccctttatcggctggagccccgca
cgcgggtactaccccaagtccgccctcggcggctcgattccgttcaagccggagttctat
tcgttcctcgcccaaggggggagggcaaaacttgccgcagcagccggtgcgccgaagccg
gtgtaccaggtgaccatcaaggggcttccgaccgatgccaatgcggaagccctcaagccg
caggggacccgtctggagctccactgcgcgacgggccctcaggtcattgccaacatgaac
tacccggtgagcaagcctttcatatggacgccggagacctgcagcgacgtcgtcctccaa
atcgagataggcgacaccgttctcaccaggagatacccaggcagtagcggcttcgccgat
ttcctgcgcgatttcccggccggccggcacacctttcacccgcgcaattttccgcacgaa
aaagaggcgctggagcggatgggggtacggttcatcaaggtcaactaccagatgtccggc
gcaggcgacatcacctcgaagcaggcagagtcgctgcccgcaaggatcccggtgaagatc
gcggagtgctgggaccagggggagccatga

DBGET integrated database retrieval system