KEGG   Geobacter sp. M18: GM18_3034Help
Entry
GM18_3034         CDS       T01421                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
geb  Geobacter sp. M18
Pathway
geb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:geb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GM18_3034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:geb02044]
    GM18_3034
Secretion system [BR:geb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GM18_3034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU Gemini_mov
Motif
Other DBs
NCBI-ProteinID: ADW14477
UniProt: E8WHS7
Position
complement(3600495..3601160)
Genome map
AA seq 221 aa AA seqDB search
MRLIDCFMPLIAYVVEFRNALPQCEADYLQVKGEIRQLLAQSEAMSQGTGCNQEEFDRSR
FIVCAWVDETLLASQWPDRQFWQHEQLQRLYYKTTDAGVEAFERLDALGQQQQAREVYCI
CLALGFRGRYIGEQGEFLLEQLRTANLKLLFEAPEAVPALNGLRLFPASLADQPATAVRV
KEPSFLSTPWGAAWLAAPVVLFAVMYLVYRYVLNGLVLPNL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagactgatcgactgcttcatgccgctgatagcctatgtcgtcgagttccgtaacgcc
ctgccgcagtgcgaagccgactacctgcaggtgaagggggaaattcggcagctgctggcg
caatccgaagcgatgtcacaagggacggggtgcaaccaggaagagttcgaccggtcacgg
ttcatcgtctgcgcctgggtcgacgagacgctcctcgcctcgcagtggcctgaccggcag
ttctggcagcacgagcagttgcagcgcctttactataagaccacggacgccggggtcgag
gcgttcgaacggctggacgccctggggcagcagcaacaggcgcgagaggtgtattgtatc
tgcctcgcccttggcttcagggggcgctatatcggtgagcagggggagtttctcctggag
cagttgaggacggcgaacctgaagctgctttttgaggctccagaggccgttcctgcgctg
aacggcctgaggctgtttccggcatccctggcagatcagccggcaaccgccgtcagggta
aaggaaccatcctttctctcgacaccgtggggggctgcctggttagccgcgccggtcgtc
ctgttcgccgtcatgtacctcgtgtaccgctatgtgctaaacggtctggtccttccgaac
ctctag

DBGET integrated database retrieval system