KEGG   Geobacter sp. M18: GM18_3035
Entry
GM18_3035         CDS       T01421                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
geb  Geobacter sp. M18
Brite
KEGG Orthology (KO) [BR:geb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:geb02044]
    GM18_3035
Secretion system [BR:geb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GM18_3035
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ADW14478
UniProt: E8WHS8
Position
complement(3601163..3602560)
AA seq 465 aa
MDAPQGPILWHQGMFLQPQHFQLAQRCTYSLFIPYQRYLVPHLWGVCRGAVRTSSVGLCA
LELTSGTFLFPDGTYVQLPGNAVVEPRMLPEGAVVKGAPVTAYVGLKKWQEQAENVSTAR
KGDVVGTITTRYVAAADGISCPDLHAGGPAAEVRQLNHVLKIFWQSELDLLGDYLLIPLA
RLEIRSEEIEISRDFIPPCLSIAASSLLFDLVREIRDQLALRCRRLESGKKQRGIQSAEF
GSKDLVYLFALRTLNRYLAQLDHFIQAGDIHPWHVYGVLAQLVAELSCFSETVSFSGDSM
ADGTVLLPEYCHLDLGGCFSQAHDLILKLLDQVTAGPEYALKLSYDGTYFCSDLKPAHFQ
GRNRFYLVVRTDAEPAAVLGSLTGLAKLSPRERLPLLIAQALPGIPLEHLPTPPRELPRR
ASSLYFGIDTRCDQWELVQKWNNIALFWDQAPDDLEAELMIVTRG
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggacgcgccacaaggtcccatcctctggcaccagggcatgttcctgcagccgcagcac
ttccagctggcgcagcgctgcacgtattccctgttcatcccgtaccagaggtatctggtg
ccgcacctttggggagtgtgccgcggggcggtcaggacctcctccgtcggcctttgcgcc
ctggaactcaccagcggcacctttttgttccccgacggaacctatgtgcaactgccgggc
aacgccgtcgtggagccgcgcatgttgcccgagggggcggtggtaaagggagccccggtg
accgcatatgtagggctgaagaaatggcaggagcaggcggaaaacgtatcgaccgcccga
aagggcgatgtcgtcggcacgataaccacgcgctacgtcgctgctgcggacggaatctcc
tgcccggatcttcacgcaggcggcccggctgcagaagtgcggcaactgaaccacgtgctg
aagatattctggcagagcgagctggaccttctgggggactacctgctcatcccgctggcc
cggctggaaatccgcagcgaggagatcgagatatcccgcgacttcatccccccttgtctc
agtatcgctgcttcttcgctgctgtttgacctggtgcgggaaatacgggaccaactcgca
ctccgttgccggcggttggagagcggcaagaagcagcgcggcatccaaagcgccgaattc
ggctcgaaggatctggtctacctcttcgccctcaggacgctgaaccggtacctggcgcag
ctcgaccatttcattcaagccggcgacattcatccctggcacgtgtatggggtcctcgcg
caactggtcgcggaactctcctgcttttccgaaaccgtctccttttccggtgattccatg
gccgacggcacggtgctactgccggagtactgccacctcgacctgggcggctgcttctcg
caagcccatgatctgatcctgaagctcctggatcaggtcacagcggggccggagtatgcg
ctcaagctctcctacgatggcacctatttctgttcggatctcaaacccgcccatttccag
ggacgtaaccggttctatctggtggtgaggacggacgcggaaccagccgcggtcttagga
tctctgaccggcctggcaaagctgagcccccgcgagaggctccctcttctgatcgcccag
gccctgccggggattcccctggaacacctccccaccccgccccgggaactcccgcgccgg
gcctcatccctctacttcggcatcgacacccgctgcgaccaatgggagctcgtgcagaag
tggaacaacatcgccctgttttgggatcaggcgccggacgaccttgaagccgaactgatg
atagtgaccagggggtga

DBGET integrated database retrieval system