KEGG   Geobacter sp. M18: GM18_3400Help
Entry
GM18_3400         CDS       T01421                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
geb  Geobacter sp. M18
Pathway
geb00260  Glycine, serine and threonine metabolism
geb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01130  Biosynthesis of antibiotics
geb01230  Biosynthesis of amino acids
Module
geb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GM18_3400
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GM18_3400
Enzymes [BR:geb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GM18_3400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADW14835
UniProt: E8WLP9
Position
complement(3971151..3972341)
Genome map
AA seq 396 aa AA seqDB search
MDTPDHSGHFGRFGGRYVSETLMPALLELEKAYNHFRNEKGFQEEYAYYLRQYVGRPNPL
YFAEKLTGKCGGAKIYLKREDLNHTGAHKVNNTIGQALLAKRMGKKKVIAETGAGQHGVA
TATVAALFGMECEVFMGVEDIRRQSLNVFRMKLLGAKVTPVSSGTATLKDAMNEAMRQWV
TYVEDTFYIIGTVAGPHPYPAMVRDFQVIIGQEARAQHLEAEGRLPDYLVAAVGGGSNAI
GLFHPFIDDASVRMIGVEAAGYGIDTGKHAAPLTAGSVGVLHGNKTYLLQDEYGQIAHAH
SISAGLDYPGVGPEHSFLKEIGRASYVSVTDDEALEAFQVLTREEGIIPALESSHAVAHA
LRLAPTLSANESIVVCLSGRGDKDIHTVADVMGVQL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttggacacgcctgaccacagtggacacttcggccgtttcggcggcagatacgtctcagaa
acgctcatgccggcgctgctcgaactcgagaaagcttacaaccattttcgcaacgaaaag
gggttccaggaggagtacgcctactacctgcgccagtacgtcgggcgccccaacccgctc
tatttcgccgagaaactgaccggcaagtgcggtggggcgaagatatacctgaagcgcgag
gacctgaaccacaccggcgcgcacaaggtgaacaacaccatcggccaggcgcttttggcc
aagcggatggggaagaagaaggtcatcgccgagaccggcgccgggcagcacggcgtggcg
acggccaccgtcgcggcgctgttcggcatggagtgcgaggtcttcatgggtgtggaggac
atccgccgccagtcgctgaacgtgttccggatgaagcttctgggggccaaggtgacgccg
gtcagctccggcaccgccaccctgaaggacgccatgaacgaggcgatgcgccagtgggtg
acctacgtggaggacaccttctacatcatcggtaccgtggcggggccccatccctacccg
gccatggtgcgcgacttccaggtcatcatcggccaggaggcgagggcgcagcaccttgaa
gccgaagggaggctcccggattacctggtcgccgcggtaggcggcggcagcaacgccata
ggcctgttccaccccttcatcgacgacgcctccgtccggatgatcggcgtcgaggcggca
ggctacggcatcgacaccggcaagcacgcggctccgcttaccgcggggagcgtcggtgtt
ttgcacggcaacaaaacctacctgctgcaggacgagtacggacagatagcccatgcccat
tccatttcggccggattggactacccgggtgtcggtccggagcactcgttcctcaaggag
atcgggcgggccagctacgtctcagtcaccgacgacgaggcgctggaggcattccaggtg
ctgacccgcgaggaggggatcatccccgcactggagtcttcgcatgcagtggcccatgca
ctgcgtctggctccgacactttctgccaatgagagcatcgtcgtctgtctgtcgggcagg
ggcgataaggacatccataccgtggccgatgttatgggggtgcagctttaa

DBGET integrated database retrieval system