KEGG   Geobacter sp. M18: GM18_3740Help
Entry
GM18_3740         CDS       T01421                                 

Definition
(GenBank) homocysteine S-methyltransferase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
geb  Geobacter sp. M18
Pathway
geb00270  Cysteine and methionine metabolism
geb00670  One carbon pool by folate
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01120  Microbial metabolism in diverse environments
geb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:geb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GM18_3740
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    GM18_3740
Enzymes [BR:geb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     GM18_3740
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     GM18_3740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR
Motif
Other DBs
NCBI-ProteinID: ADW15167
UniProt: E8WQT0
Position
complement(4377546..4379375)
Genome map
AA seq 609 aa AA seqDB search
MKGTFLERIAAGVLIGDGAIGTMLYAKGVAPEANFEHLNLVRPELVLELHREYLAAGAQV
IETNTFGANYAKLSAIGLGAKVAEINRKGAQLAKSAAAGRDVFVAGSIGPLGRGKSELTG
EQAADCFRVQSAALAEGGVDLLILETFSELDELLTALAAARETGLPVVASLAFGEGGRLP
GGILAESAAQRLAAAGADLVGANCGAGPLELLATVRRISAACPLPLAAYPNSGFPEYLDG
RYIYRTTPEYFADRAEELIAAGASLVGGCCGTTPEHIKVMAQRLQGRKPAARVAVSVAGS
ALEEERGEKVQVGFLDRWGTEPVITVELDPPKGLDCARVLAGSRALKDAGAHAINLAENP
LARVRMGNLALASLIRREVGIEVIAHVTCRDRNLIGMQSELMGASLLGVSSILAVTGDPA
SLGDEAGASSVFDLNSFTLIKLLSDLNRGVNALGNPIGAGTGFAIGAAFNPNTQKMEVQV
GRLARKVANGARFAQTQPIYDLERFEQMMEQTAHLGIPILPGVLPLVSGRNAEFLHNEVP
GIVIPEGIRARMAGKTGEEGVAEGLAIAKEFIEAAGAKAGGFYLIPPFGKYEIAVELVQF
IKSLRRPLP
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaacgttcctggaacggatcgcggcaggagtgctgatcggcgacggcgccatc
ggtaccatgctttacgccaagggtgtggcaccggaagccaacttcgagcacctgaacctg
gtgcgtccggagcttgtgctggagctgcatcgggagtatctggcagcgggcgcgcaggtc
atcgagaccaacaccttcggcgccaactacgccaagctctccgccatcggcctgggcgcg
aaggtggccgagatcaaccggaaaggggcacagctcgcgaagagcgccgccgcgggaagg
gacgtcttcgtggccggctccatcggccccctggggcgcggcaagagcgagctgaccggc
gagcaggccgccgactgcttccgcgtgcagtctgcagcgctggccgagggaggggtggac
ctcctgatcctggaaaccttctccgagctggatgaacttctgaccgcccttgccgctgcc
agggagaccgggcttcccgtggtcgccagcctcgccttcggcgaaggggggcgcctgcct
ggggggatccttgccgaaagcgcggctcagcgtctggctgccgccggggcggacctggtg
ggcgccaactgcggcgccggtccgctggagctcctggccacggtgaggcgcatctccgcc
gcctgcccgctgccgctggccgcctaccccaacagcggcttccccgaatacctggacggg
cgctacatctatcgcaccacacccgagtacttcgccgaccgcgccgaggaactgatcgct
gcaggcgcttccctcgtcggaggctgctgcggtaccacgcctgagcacatcaaggtcatg
gctcagaggctgcaagggcgcaagcccgcggcgcgcgtcgccgtctccgttgccggcagc
gcgctcgaggaagagcgcggcgagaaagtgcaggtcggcttcctcgacagatgggggacc
gagccggtaatcaccgtggagctggaccctccgaaaggactcgactgcgccagggttctg
gccgggagccgcgccttgaaggacgcaggggcccatgccatcaacctcgccgagaacccg
ctggcccgcgtgcgcatggggaacctggcgctcgcctcgctgatccgccgcgaggtgggg
atcgaggtgatcgcgcacgtcacctgccgcgaccgcaacctcatcgggatgcagtccgaa
ctgatgggggcgagccttttgggcgtgagttccatccttgcggtcaccggcgacccggcg
agtctgggtgacgaggcgggcgcctcctcggtcttcgacctcaactcgttcaccctcatc
aagctcctgagcgacctgaaccgcggggtgaacgccctggggaacccgatcggcgcaggg
accggtttcgccatcggcgccgccttcaaccccaacacccagaagatggaggtgcaggtg
ggaaggctggccaggaaggtggccaacggcgcccgtttcgcgcagacgcagccgatctac
gatctggagcgtttcgagcagatgatggagcagacggcccacctggggattccgatcctt
cccggcgtgctgccgctggtctccggcagaaatgccgagttcctgcacaacgaggtcccg
ggcatcgtcatcccggagggcatcagggcacgcatggccggaaagaccggtgaggagggg
gtcgccgagggtctcgccatagccaaggagttcatcgaggcggccggcgccaaggccggt
ggcttctacctgataccccccttcggcaagtacgagatcgcggtagagttggtgcagttc
atcaagagcctgcgcaggccgctcccatga

DBGET integrated database retrieval system