KEGG   Geobacter sp. M18: GM18_3970Help
Entry
GM18_3970         CDS       T01421                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
geb  Geobacter sp. M18
Pathway
geb00860  Porphyrin and chlorophyll metabolism
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01120  Microbial metabolism in diverse environments
Module
geb_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GM18_3970
Enzymes [BR:geb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GM18_3970
Exosome [BR:geb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GM18_3970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ADW15389
UniProt: E8WTA6
Position
complement(4653324..4654343)
Genome map
AA seq 339 aa AA seqDB search
MFYPVYRARRIRGKEVFRNMVRETSISANDLIYPMFSAFGKGIKKEISSMPGIYQQSIEN
IVEEAQEAYELGVPAVILFGIPEQKDAMGSDAYSETGIIQETIRAIKKSVPKLAVITDVC
MCEYTDHGHCGVIKNGDVDNDETLELLAREALSHAQAGADMVAPSDMMDGRVAAIRESLD
NNGFNQIPLMSYAVKYASGYYGPFREAAESTPQFGDRRSYQMDPGNRLEAIREARMDVEE
GADILMVKPGLPYLDIVREVRNEFNLPTAVYNVSGEYSMVKAAAKMGWIDEDRVIMETMM
SFKRAGADLILTYHSKEVAKLLRKGYEAELNGRCGCGCR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttctacccggtgtacagagcgagacgaattcggggcaaggaagtcttcagaaacatg
gtcagggagacctccatctccgccaacgacctgatatacccgatgttttcggccttcggc
aagggaatcaagaaagagatctcctccatgccgggcatctaccagcagtccatcgagaac
atcgttgaagaagcccaggaagcctacgagctgggtgtcccggccgttatcctcttcggc
atcccggagcagaaggacgccatgggtagcgacgcctactccgagaccggcatcatccag
gagaccatccgcgccatcaagaagagcgtgcccaagctggccgtcatcaccgatgtatgc
atgtgcgagtacaccgaccacggccactgcggcgtgatcaaaaacggcgacgtcgacaac
gacgagaccctggagcttctggcccgcgaggcgctctcccacgcccaggcaggcgccgac
atggtcgccccctccgacatgatggacggccgcgtggcagccatccgcgagtcgctggac
aacaacggcttcaaccagatcccgctgatgagctacgccgtgaagtacgcctccggctac
tacgggccgttccgcgaggcagccgagtccaccccgcagttcggtgaccgccggtcctac
cagatggatccgggcaaccggctggaggctatccgcgaggcacgcatggacgtcgaggaa
ggcgccgacatactgatggtcaagccgggcctgccgtatctcgacatcgtgcgcgaggtg
agaaacgagttcaacctcccgaccgccgtgtacaacgtctccggcgagtacagcatggtg
aaggccgccgccaagatggggtggatcgacgaggaccgcgtgataatggagaccatgatg
tccttcaagcgggccggtgccgacctgatcctgacctaccactccaaggaagtcgcgaag
ctgctgcgcaaggggtatgaggcggaactgaacggccgttgcggctgcggctgcaggtaa

DBGET integrated database retrieval system