KEGG   Geobacter sp. M18: GM18_4211Help
Entry
GM18_4211         CDS       T01421                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
geb  Geobacter sp. M18
Pathway
geb00330  Arginine and proline metabolism
geb00332  Carbapenem biosynthesis
geb01100  Metabolic pathways
geb01130  Biosynthesis of antibiotics
geb01230  Biosynthesis of amino acids
Module
geb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GM18_4211
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    GM18_4211
Enzymes [BR:geb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GM18_4211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADW15625
UniProt: E8WI00
Position
complement(4952446..4953567)
Genome map
AA seq 373 aa AA seqDB search
MRKELLKKVKRIVVKIGSGVLTSEDNGIDPRFLDGLASQIAGLREKGIEVVVVSSGAVAA
GRQALGLPDRPRTLPQKQAAAAIGQSRLMRAYEEAFSGYELKVAQILLTRDDLASRRRFQ
NARGTLDTLLSCGIVPVINENDTVVVDELKFGDNDNLSALVTNLVEAQLLLIMTDIDGLY
TADPRTDPSATLIHQVGAVTREMERGAGGSGTSVGTGGMATKLAAAKKVVKSGVAAIIFA
GKGEGNLARVMSGELLGTLFLPAGESLNRRKHWIAFTIKPAGSIVVDAGARGALSRHGKS
LLPSGIAKVEGRFDRGACVRVLDQDGVEFARGIVDYSSQEIEKICRHKSSEIEQILGFRY
GDDVIHRDNLVIL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaggaactgctcaagaaggtgaagaggatcgtggtgaagatcggctccggcgtc
ctgaccagcgaggacaacggcatcgacccgcgtttcctggacgggctcgcctcgcagatc
gcggggctgcgcgaaaaggggatcgaggtggtcgtggtctcctccggcgccgtggcggcg
gggcgccaggcgctgggtctgccggaccgcccacggaccctgccgcagaagcaggccgcg
gccgccatcggccagtcgcgactgatgcgcgcctacgaggaggccttctcgggctacgag
ctgaaggtcgcccagatccttctgaccagggacgacctggccagccggcgccgcttccag
aacgcccgcggcacgctcgataccctgctttcctgcggcatcgtcccggtcatcaacgag
aacgacaccgtcgtggtcgacgagctgaaattcggcgacaacgacaacctctccgcgctg
gtcaccaacctggtggaggcgcagctcctgctgatcatgaccgacatcgacggcctctac
accgccgatccgcgcaccgacccgagcgccacgctgatccaccaggtgggcgcggtgacc
cgcgagatggagcgcggcgccggggggagcggcaccagcgtcgggaccggcggcatggcg
accaagcttgccgcggccaagaaggtggtcaagtccggcgtcgccgccatcatcttcgcc
ggcaagggggaggggaacctggcccgggtgatgagcggggaactcctggggacgctgttc
ctccccgccggggagtcgctgaaccggcgcaagcactggatcgccttcaccatcaagcct
gccggcagcatcgtggtcgatgccggcgcccggggcgcgctttcccggcacggcaagagc
ctgcttccctccgggatcgccaaggtggaggggcgcttcgatcgcggcgcctgcgtcagg
gtactggaccaggacggggtcgagttcgcccgcggcatcgtcgactactcaagccaggag
atcgagaagatctgccgccacaagagcagcgagatcgaacagatcctcggtttccgctac
ggcgacgacgtgatccaccgggacaacctggtcattctctga

DBGET integrated database retrieval system