KEGG   Candidatus Gullanella endobia: FVIR_GE00315Help
Entry
FVIR_GE00315      CDS       T04502                                 

Gene name
fbaA
Definition
(GenBank) Fructose-bisphosphate aldolase class 2
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
ged  Candidatus Gullanella endobia
Pathway
ged00010  Glycolysis / Gluconeogenesis
ged00030  Pentose phosphate pathway
ged00051  Fructose and mannose metabolism
ged00680  Methane metabolism
ged01100  Metabolic pathways
ged01110  Biosynthesis of secondary metabolites
ged01120  Microbial metabolism in diverse environments
ged01130  Biosynthesis of antibiotics
ged01200  Carbon metabolism
ged01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ged00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FVIR_GE00315 (fbaA)
   00030 Pentose phosphate pathway
    FVIR_GE00315 (fbaA)
   00051 Fructose and mannose metabolism
    FVIR_GE00315 (fbaA)
  09102 Energy metabolism
   00680 Methane metabolism
    FVIR_GE00315 (fbaA)
Enzymes [BR:ged01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     FVIR_GE00315 (fbaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: CUX96177
UniProt: A0A143WRM2
Position
I:complement(565268..566344)
Genome map
AA seq 358 aa AA seqDB search
MSNFLDFIKPGVITGDDIQKVFAVAKENSFALPAINCVGTDSINAALETAAKVRAPIIVQ
FSNGGSAFIAGEGLKDKGQTSAVLGAVSGALHVHHIAEYYGVPVILHTDHCTKKLLPWLD
GLLDIGEKYYETTGKPLFSSHMLDLSEESLEENIKISANYLTRMAKLNMTLEIELACTGG
EEDGVDNSHIDNSALYTKPEDLAYAYQKLHEISSCFTIAAAFGNVHGVYRPGNVRLMPKI
LESSQKYVSEKFGLPAKPLNLVFHGGSGSTPEEIKEAISYGVVKMNIDTDTQWATWEGIL
KYYQKNKDYLQAQLGNSKGIDKPNKKFYDPRAWIRAGQISMKARLEKAFKELNSINVL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctaattttttagattttattaaaccaggcgtcattactggtgatgatattcaaaaa
gtgttcgctgttgcgaaagaaaacagttttgctttgccagctattaattgtgtaggtact
gattctattaatgccgcattagaaacagcagctaaagtacgtgcaccgattatcgtgcag
ttttcaaacggtggttctgcctttattgcaggagaaggcttaaaagataaaggacaaact
tcagctgtcttaggggcagtatctggtgcactacatgtacatcatatagctgaatattat
ggtgttcctgtcattctacatactgatcattgtactaaaaagctgctaccttggcttgac
gggttactggatattggcgagaaatactatgaaactactggtaaaccattattttcatcc
catatgcttgatctctccgaagagtcacttgaagaaaatataaaaattagcgcgaactat
ctaacacgtatggcaaagcttaatatgacgttggaaatcgaactagcttgtactgggggc
gaagaagatggtgtagataatagccatatagataactctgcattgtatactaaaccagaa
gatcttgcttatgcctatcaaaaactacatgaaatcagctcatgttttactattgcagct
gcgtttggtaacgttcatggtgtatatagaccaggtaacgtacggctgatgccaaaaatt
ttggagagttcacagaaatatgtatctgaaaagtttggtttaccggcaaaacctttaaat
ttggtcttccatggcggatcaggctctacaccagaagaaattaaggaagctattagctac
ggtgtggtaaaaatgaatatcgatactgatactcagtgggccacttgggaaggaattcta
aagtattatcaaaagaacaaagattatctgcaagctcaattgggtaattcgaaaggtatt
gataaaccaaacaagaaattctatgatccgcgtgcatggattcgcgctggtcaaatttct
atgaaggctcgcctagaaaaagccttcaaagaactaaactctatcaacgtactatag

DBGET integrated database retrieval system