KEGG   Candidatus Gullanella endobia (Ferrisia virgata): FVIR_GE00508
Entry
FVIR_GE00508      CDS       T04502                                 

Gene name
lnt
Definition
(GenBank) Apolipoprotein N-acyltransferase
  KO
K03820  apolipoprotein N-acyltransferase [EC:2.3.1.269]
Organism
ged  Candidatus Gullanella endobia (Ferrisia virgata)
Brite
KEGG Orthology (KO) [BR:ged00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FVIR_GE00508 (lnt)
Enzymes [BR:ged01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.269  apolipoprotein N-acyltransferase
     FVIR_GE00508 (lnt)
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-ProteinID: CUX96347
UniProt: A0A143WS47
Position
I:complement(902358..903902)
AA seq 514 aa
MINTSLFTQQWFRILLALVTGACGTIAFSPYNFWPSAIISLGGLLLVTLNRNVLQASCLG
FFWGFSLFGTGINWIYVSIAQFSGLPDIFNVILVIILITYLALYPMLFSILLIVLWPRVN
FCRLVLGAPVLLLVTEFLRSRILTGFPWLEFGYSQIDGPLKGIAPLLGVQAITFILMVIS
GLSVYAIEKRRLLPAVAVLTILVLLYPLYSLHWYEPQPERAIDVTLVQGNIAQSIKWEAK
QVISTLDIYLQHTLKAIGKSKIVIWPESAIPENEMLQNDFLTKLDKQLKKGNTRLVTGII
DARPTINGYHYYNSIIVLGESIPYRYPSKNRYNKHHLVPFGEIIPCSSLFRLLSSLFNFP
IFSLSQGDYLQPQLRVANMNLTATICYEIILGSQVRDNFHSNTDFLLTILNDAWFGHSIG
PWQHFQMARMRSLELGRPLLHSSNNGITAVIDATGMPQAQLPQFKCDVLNIRVIPTKGMT
PYARVGSWPLWIFTILVGVSALVFDHFKQIKFLI
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgatcaatacttcactgtttacacaacagtggttccgtatactactagcgctcgttacc
ggcgcctgtggtactattgcattttctccttacaatttttggccttcagctattatttcg
ctaggtggtttgcttttagttactctaaatcgtaacgttttgcaagctagctgtcttggt
tttttctggggttttagcttattcggcactggcattaattggatctatgttagtatcgct
cagttcagtggtttaccagatatattcaatgtgatactagtaataatactcattacctac
ctagcactgtatcctatgttgttttccatcctactaatagtgctctggccacgtgtaaac
ttttgtcgattagtactcggagcaccagtgttattattagttaccgaatttttacgcagt
cggatactaacaggctttccctggttagaatttggctatagccagatagacggtccattg
aaaggtatagcgccgttattgggtgtacaagcgattacattcatattaatggtaataagc
gggctgtcagtctatgcaatagaaaaaaggcgacttttacctgctgttgctgtattgaca
attttagtgttgctatatcctctatattcgctgcattggtacgagcctcaaccagagcga
gctattgacgttacattagtgcaaggtaatattgctcaatcaataaaatgggaagcgaaa
caagtgatatcgacattagatatttacttacagcataccctaaaagctattggtaaatcg
aagatagttatctggccagaatcagctataccagaaaatgagatgctccaaaacgatttc
ttaaccaaacttgataaacagttaaaaaaaggaaataccagattagttactggtattatt
gatgcacgacctactattaacggttatcactactataatagtattatagtattaggcgaa
tctataccctatcgatatccctctaaaaatcgatataataaacatcacttagtaccattt
ggtgaaatcataccatgttcaagtttatttcggttactatcgtctctattcaattttcca
atattctcacttagtcaaggagattatttacaaccgcaactacgggtagctaatatgaat
cttactgctactatctgttatgaaattatcttgggtagtcaagtacgagataattttcac
tctaataccgacttcttattaacaatattaaacgatgcttggtttgggcattctattggt
ccttggcaacattttcaaatggcacgtatgcgctcattggagctaggacgacctctacta
catagtagtaataacggtattacagcagttattgatgctactggaatgccacaggcgcaa
ttaccacaatttaaatgtgatgtactaaatattcgcgtgatcccaacaaaaggaatgact
ccttatgcccgcgttggatcttggccactatggatttttacaatactcgtcggagttagt
gcactagtttttgatcactttaaacaaataaaattcttaatttaa

DBGET integrated database retrieval system