KEGG   Candidatus Gullanella endobia (Ferrisia virgata): FVIR_GE00509
Entry
FVIR_GE00509      CDS       T04502                                 

Gene name
ybeY
Definition
(GenBank) Endoribonuclease YbeY
  KO
K07042  probable rRNA maturation factor
Organism
ged  Candidatus Gullanella endobia (Ferrisia virgata)
Brite
KEGG Orthology (KO) [BR:ged00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ged03009]
    FVIR_GE00509 (ybeY)
Ribosome biogenesis [BR:ged03009]
 Prokaryotic type
  Other maturation factors
   FVIR_GE00509 (ybeY)
SSDB
Motif
Pfam: UPF0054
Other DBs
NCBI-ProteinID: CUX96348
UniProt: A0A143WRJ9
Position
I:complement(904546..905010)
AA seq 154 aa
MSDVILNLQIACDETRYLPDKDDFLRWLREVLPRFRDYSEVTIRLVDEAESHELNIIYSG
KNRPTNILSFPLELALEVKLSLIGDLVICCQVIEREAQQQGKTLEAHWAHIVIHGSLHLL
GYDHILNKEALEMELLETKIMQKLGYPDPYLSEK
NT seq 465 nt   +upstreamnt  +downstreamnt
atgagcgatgtaatacttaatttacagatagcttgcgacgaaacacgatacctacctgat
aaagatgattttttgcgttggcttcgggaagttctgccacgatttcgcgattattcagaa
gttactattcgtttagtagatgaggcggaaagccacgaacttaatataatatatagtgga
aaaaatagacccacaaatatactttcttttcctctagagttagcattggaagtaaaattg
tcactcataggagatctggtaatctgttgtcaagttatagaacgcgaagcgcagcaacag
ggaaaaacgctagaagcacattgggctcatatagttattcatggttcactgcatctatta
gggtatgatcatatattgaataaggaagctctggaaatggaattgttagaaactaagata
atgcaaaaacttggttatccagatccttatctttcggaaaaatag

DBGET integrated database retrieval system