KEGG   Candidatus Gullanella endobia (Ferrisia virgata): FVIR_GE00514
Entry
FVIR_GE00514      CDS       T04502                                 

Gene name
glnS
Definition
(GenBank) Glutamine--tRNA ligase
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
ged  Candidatus Gullanella endobia (Ferrisia virgata)
Pathway
ged00970  Aminoacyl-tRNA biosynthesis
ged01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ged00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FVIR_GE00514 (glnS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ged01007]
    FVIR_GE00514 (glnS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ged03016]
    FVIR_GE00514 (glnS)
Enzymes [BR:ged01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     FVIR_GE00514 (glnS)
Amino acid related enzymes [BR:ged01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   FVIR_GE00514 (glnS)
Transfer RNA biogenesis [BR:ged03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    FVIR_GE00514 (glnS)
 Prokaryotic type
   Other AARSs
    FVIR_GE00514 (glnS)
SSDB
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C
Other DBs
NCBI-ProteinID: CUX96349
UniProt: A0A143WU16
Position
I:910350..912005
AA seq 551 aa
MSEIEARQTNFIRQIIDNDLASGIHTSIHTRFPPEPNGYLHIGHVKSICLNFGIAQDYQG
KCNLRFDDTNPVKENIEYVNSIKHDLQWLGFNWSGDIHYSSDYFEKLYDYALELIDKGLA
YVDKLSPDKIRDYRGTLTCPGKNSPYRNQSVEENRILFARMRQGEFSEGSACLRAKIDMA
SPFMIMRDPVLYRIKFTDHYQIGNKWCIYPMYDFTHCISDALEGITHSLCTLEFQDNRRL
YDWILDNITIDVHPRQYEFSRLNLEYTVMSKRKLNLLVMEKIVEGWDDPRMPTISGLRRR
GYTAASIREFCRRIGVTKQDNNIEMAVLEACIREDLNDRACRIMAVIDPVKVVIESLPKG
YEQDIVMLNHPNKPNMGTRHVAFSREIYIDRADFKEEANKGYKRLILGKEVRLRNAFVIN
AERIEKDNKGKITTIFCRHDPDTLNKNPADGRKVKGVIHWVSATRSFKAEFRLYDRLFID
PNPAMTEDFLSKLNPNSLVIRKGFVEAGVLTDNIKGPFQFEREGYFCADSHDFTSTHPVF
NRIVKLRSTYL
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgagtgagattgaagcacgccaaacaaatttcattcgtcaaattattgataatgatcta
gcttcaggaatacatacatcgatacatactcgtttcccgccagagccaaatggatattta
catatcggtcatgttaaatcgatttgccttaattttggaattgctcaagattatcagggt
aaatgtaacttacgtttcgatgatacaaatccggttaaagaaaatattgaatatgttaat
tctattaaacatgatttgcagtggcttggttttaattggagtggtgatattcactattct
tccgattattttgaaaaattgtatgactatgcacttgagttaattgataaaggtctagcc
tatgttgacaaactatcaccagataaaatccgagattatcgtggtactttgacatgtcca
ggcaaaaatagtccttaccggaatcaaagtgtagaagaaaatcggatattatttgctaga
atgcgccaaggtgaattttctgaaggcagcgcctgcttacgagcaaaaattgatatggcc
tcaccatttatgataatgcgtgacccagttttgtatcgaattaaattcactgatcactat
caaattggaaataagtggtgtatttatccaatgtatgattttactcactgtatctccgat
gcattagaaggtattactcattcgctttgtacattagaatttcaggataatcgtcgatta
tatgattggatactagataatatcacgatcgacgtacatcctaggcagtatgaattttcc
cgacttaatcttgaatatactgttatgtctaagcgaaaactaaatcttttggttatggag
aaaattgttgaaggatgggatgatccacgcatgcctactatttcaggtttacgacgacgc
ggctatacagcggcttcaattcgtgaattttgccgccgaatcggtgtgacaaaacaggat
aacaatattgagatggctgtattggaagcttgtatacgagaagatttaaatgatcgcgct
tgtcgcattatggctgttattgatcctgttaaggtagtcatcgaaagtctacctaagggg
tatgaacaggatattgtaatgctaaatcatcccaataagcctaacatgggaactcgtcat
gtagcattcagtagagaaatttatatcgatcgtgccgattttaaagaagaagcaaataag
gggtataaacgtttgatattaggtaaagaagtgcgcttacgaaatgcatttgtaattaat
gctgaacgtatagaaaaagataataaaggaaaaatcactacaattttttgccgtcacgat
cctgatactttaaataaaaatccagcagatggacgtaaggtgaaaggtgtaatccactgg
gtatcagccactcgtagctttaaagcagaatttcgtctatatgatcgattatttatcgat
cctaacccagcgatgacagaagattttctttctaagctaaatcctaattcgttggttatc
cgtaagggttttgtcgaagcaggtgttttaacagataatatcaaaggaccctttcagttt
gaaagagaaggttatttttgtgctgatagtcacgatttcactagtacgcatccagtattt
aatcgcatagtaaaactaagaagcacctatttataa

DBGET integrated database retrieval system