KEGG   Candidatus Gullanella endobia (Ferrisia virgata): FVIR_GE00515
Entry
FVIR_GE00515      CDS       T04502                                 

Gene name
fldA
Definition
(GenBank) Flavodoxin-1
  KO
K03839  flavodoxin I
Organism
ged  Candidatus Gullanella endobia (Ferrisia virgata)
Brite
KEGG Orthology (KO) [BR:ged00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    FVIR_GE00515 (fldA)
SSDB
Motif
Pfam: Flavodoxin_1 Flavodoxin_3 Flavodoxin_5
Other DBs
NCBI-ProteinID: CUX96350
UniProt: A0A143WRL9
Position
I:complement(912250..912765)
AA seq 171 aa
MKKIGIFFGSDTGNTENIAMIIQKQLGTSIANVFDIAKSSKEDLEQYDRLILGTPTWYYG
EAQCDWDDFFSTLKEINFNKKIVALFGCGDQEDYAEYFCDAMGILRDIIKPNGAKLVGYW
PTTGYHFKTSQGLVDDYQFVGLAIDEDRQPELTAKRVSTWVKQVTIEMNLD
NT seq 516 nt   +upstreamnt  +downstreamnt
atgaaaaaaataggcattttttttggtagtgataccggaaacaccgaaaatattgctatg
ataatccagaagcaactaggtactagtattgctaatgtttttgatattgctaaaagcagc
aaagaagatctagaacaatatgatcgtctgatattaggtaccccaacctggtattatggt
gaagcacagtgtgattgggatgattttttttctacactgaaagagattaattttaataaa
aagattgttgcattatttgggtgtggtgatcaggaagactatgcagagtatttctgcgat
gcaatgggtatattacgagatattattaaaccaaacggtgctaagttagttggatattgg
cccaccactggatatcattttaagacatcgcaaggacttgttgatgattatcagtttgtt
ggtctagctattgacgaagatcgacagccagagctaactgctaaacgtgttagcacttgg
gttaaacaagtaaccatagaaatgaatttagattaa

DBGET integrated database retrieval system