KEGG   Candidatus Gullanella endobia (Ferrisia virgata): FVIR_GE00516
Entry
FVIR_GE00516      CDS       T04502                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ged  Candidatus Gullanella endobia (Ferrisia virgata)
Pathway
ged00020  Citrate cycle (TCA cycle)
ged00640  Propanoate metabolism
ged01100  Metabolic pathways
ged01110  Biosynthesis of secondary metabolites
ged01120  Microbial metabolism in diverse environments
ged01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ged00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FVIR_GE00516 (sucC)
   00640 Propanoate metabolism
    FVIR_GE00516 (sucC)
   00660 C5-Branched dibasic acid metabolism
    FVIR_GE00516 (sucC)
Enzymes [BR:ged01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FVIR_GE00516 (sucC)
SSDB
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Other DBs
NCBI-ProteinID: CUX96351
UniProt: A0A143WRX5
Position
I:917305..918471
AA seq 388 aa
MNLHEYQAKKLFAHYGLTTPKGYTCNTPNEAEVFASKIGSGPWIVKCQVHAGGRGKFGGV
KVVQSKKEIYDFAEQWLGKRLVTYQTDTLGQPVNQILIEETIEIYKELYLGAVIDRDICR
VVFLASTEGGVEIEKVAEKTPNLIHKIALDPLTGPQPYQGRELAFKLGLTGNQISQFSKI
FIGLAMLFLDQDLDLLEINPLVITNTGNLICLDGKISVDNNALFRQPELYKMRDHSQEDE
REAYASQWELSYVALDGNIGCMVNGAGLAMGTMDIVKLHGGKPANFLDVGGCANKERVSE
AFKIILSDKKVKAVLVNIFGGIVRCDLIANGIIGAVSDVGVNVPVVVRLEGNNAELGVKQ
LANSRLNIIAAISLTDAVQQVIASVEVK
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgaatttacatgaatatcaggcaaaaaagctatttgctcattatggtctcactactcca
aaaggatatacttgtaatacgccgaatgaagcagaagtattcgcttcaaaaatcggctcc
ggtccatggatagtaaaatgtcaggtgcatgcaggtggtcgcggtaaatttggtggtgta
aaagtagtacaatcaaaaaaagaaatctatgatttcgctgagcagtggttaggtaagcgt
ctagtaacctatcaaacggatacattaggtcaacctgttaatcagattctaattgaagaa
actatcgaaatctacaaagagctttatttaggagcagttatcgatcgcgatatatgccgt
gtggtatttctagcatctaccgaaggtggagtagagattgaaaaggtggcggaaaaaaca
ccgaatctaattcataaaatagctttggatccacttacgggtccgcagccttatcaaggc
cgcgaattagcttttaaactaggtttaaccggtaatcagatttctcaatttagtaaaatt
ttcataggtctagcaatgctgtttttagatcaagatttagatctattagaaattaatcca
ttagtgattactaacactggtaatcttatctgtcttgatggaaaaataagtgttgataat
aatgcgttattccgacaaccagagttatacaagatgcgtgatcatagccaagaagatgaa
cgcgaagcatacgcaagccaatgggagttaagctatgtagcgctagatggtaatattggg
tgtatggtaaacggggctggtctagcaatgggaacaatggatattgttaaattacacggc
ggaaaaccagctaatttcctagatgttggcggatgtgctaataaagagcgtgtctctgag
gcattcaaaattatcttatcagataaaaaagttaaagcagttctagttaatattttcggg
ggaattgttcgctgcgatttaattgctaatggtatcattggagcggtatctgatgtgggt
gtcaacgttcccgtagtagttcgcctagaagggaataatgctgaactaggtgtaaagcaa
ttagcaaatagtagattgaacatcattgctgctataagtctgaccgatgcagttcagcag
gttattgcttcagtagaggtaaaataa

DBGET integrated database retrieval system