KEGG   Candidatus Gullanella endobia (Ferrisia virgata): FVIR_GE00517
Entry
FVIR_GE00517      CDS       T04502                                 

Gene name
sucD
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
ged  Candidatus Gullanella endobia (Ferrisia virgata)
Pathway
ged00020  Citrate cycle (TCA cycle)
ged00640  Propanoate metabolism
ged01100  Metabolic pathways
ged01110  Biosynthesis of secondary metabolites
ged01120  Microbial metabolism in diverse environments
ged01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ged00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FVIR_GE00517 (sucD)
   00640 Propanoate metabolism
    FVIR_GE00517 (sucD)
   00660 C5-Branched dibasic acid metabolism
    FVIR_GE00517 (sucD)
Enzymes [BR:ged01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FVIR_GE00517 (sucD)
SSDB
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Other DBs
NCBI-ProteinID: CUX96352
UniProt: A0A143WRJ1
Position
I:918471..919343
AA seq 290 aa
MSILINKNTKVICQGFTGNQGTFHSKQALAYGTKMVGGITPGKGGSRHLGLPVFNTVREA
VDKTGAKASVIYVPAPFCKDSILEAVDASIELIICITEGIPTLDMLTVKAKLEKSCSRMI
GPNCPGVITPGECKIGIMLGHIHQPGRVGIVSRSGTLTYEAVKQTTDIGLGQSTCVGIGG
DPIPGSNFIDILKLFEADMQTEAIVMIGEIGGRAEEEAAVYIKNHITKPVVGYIAGVTAP
KGKRMGHAGAIISGGKGTADEKFAALESAGVKTVRSLTDIGQALKLILSN
NT seq 873 nt   +upstreamnt  +downstreamnt
atgtctattttgattaataaaaatactaaagtgatttgccagggctttaccggtaatcag
ggaacattccattctaaacaggcgttggcttatggtaccaaaatggttggtggtatcacg
ccaggtaaaggcggtagtagacatctcggtttgccagtatttaatactgtgcgagaagct
gttgataaaactggtgcaaaagcatcagttatctacgtaccagcaccattttgtaaagat
tcaatactagaagctgttgatgctagtattgagttgattatctgtatcactgaaggtata
ccaacgctagatatgctaacagtgaaagctaagcttgaaaaaagttgttcgcgtatgatc
ggaccaaactgtccaggtgtcattactcctggagaatgtaaaattggtattatgcttgga
catattcatcagccaggtcgagttggtattgtatctcgttcaggtactctaacctatgaa
gcggtaaagcaaacaaccgatattggtcttggacaatcaacctgcgttggaatcggcgga
gacccaattcctggctcaaatttcatcgatattcttaagctatttgaagcggatatgcaa
acagaagctattgtgatgattggtgaaattggtggtagggcagaagaagaagctgcagtc
tatattaagaatcatatcactaaaccggttgtaggttatattgctggtgttacagctccg
aagggaaaacggatgggtcatgctggcgcaattatctccgggggtaaaggtacggcagat
gaaaaattcgccgccttagaatctgctggcgttaagaccgtacgtagtttgacagatatt
ggtcaagcactaaaattgattttatcaaactaa

DBGET integrated database retrieval system