KEGG   Candidatus Gullanella endobia (Ferrisia virgata): FVIR_GE00518
Entry
FVIR_GE00518      CDS       T04502                                 

Gene name
cydA
Definition
(GenBank) Cytochrome bd-I ubiquinol oxidase subunit 1
  KO
K00425  cytochrome bd ubiquinol oxidase subunit I [EC:7.1.1.7]
Organism
ged  Candidatus Gullanella endobia (Ferrisia virgata)
Pathway
ged00190  Oxidative phosphorylation
ged02020  Two-component system
Module
ged_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:ged00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FVIR_GE00518 (cydA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FVIR_GE00518 (cydA)
Enzymes [BR:ged01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)
     FVIR_GE00518 (cydA)
SSDB
Motif
Pfam: Cyt_bd_oxida_I DUF3099
Other DBs
NCBI-ProteinID: CUX96353
UniProt: A0A143WRP5
Position
I:920026..921591
AA seq 521 aa
MFDIVELSRLQFALTAMYHFLFVPLTIGMSFLLAIMETVYVLSGKQIYKDMTKFWGKLFA
INFALGVATGLTMEFQFGTNWSYFSHYVGDIFGAPLAIEGLIAFFLESTFVGLFFFGWDR
LSKLQHMAVTWLVALGSNLSALWILVANGWMQNPIASDFNYETMRMEMISFIDLIFNPVA
QVKFFHTVTAGYCSSVMFILGISSFYLLKGRDIAFAKRSFAIAASFGLASVLLVIMLGDE
SGYEMSNVQKTKLAAIEAEWNTEPAPASFTLFGLPNQKEQTNYFSIRIPYVLGIIATRST
NRHITGLKDLMVQHEIRIRNGMKAYSLLKQLREGNTNPIVRKAFINSKQDLGYGLLLKRY
TDDITQANEQQICQATRDSIPQVAPLYFSFRIMVGCSVIMLMLIAFCFLAVIRNRIGQPR
WLQYAMLYGIPLPWIAIESGWFIAEYGRQPWAINEILPTYIAHSTLTTHEILFSMGLICG
LYTLFLLAEIYLIFKFARLGPSSLKTGNYYFEKLSSSISVQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtttgatatcgttgaactatcacgattacagtttgctttaacagcgatgtaccatttc
ctgtttgtgcctctcaccataggcatgtcgtttttattggcgatcatggaaacagtttat
gtgttatcaggtaagcaaatttataaagatatgaccaagttttggggtaagttatttgct
atcaacttcgctcttggtgtagctaccggtcttactatggagtttcaatttggtactaat
tggtcatacttctcccattatgtcggtgatatatttggcgcaccattagcaattgaagga
ttaatagccttttttttagaatcgacctttgttggcctgttttttttcgggtgggatcga
ttaagcaaattacagcatatggcggtgacttggctggtagcacttggttctaatttatct
gcattatggattctagtagctaacggttggatgcaaaatcctattgcttcagattttaat
tatgaaaccatgcgtatggagatgattagttttatcgatctaatattcaacccagtagca
caagtaaaattttttcatactgtaactgctggctactgtagcagcgtgatgtttatcctt
ggtatcagctctttttatttattaaaaggtcgtgatattgcttttgccaagcgttctttc
gctatagctgcttctttcggtctagcgtcggtactgttagtcattatgctaggagatgaa
tctggttatgaaatgagtaatgtgcaaaagaccaagttagctgcaatcgaggcagagtgg
aatactgaaccagcaccagcatcctttactttatttggccttccaaaccaaaaagagcaa
accaattatttttcgattcgtattccttacgtactgggaattattgcaacccgttcaaca
aatcgccatattactggcctgaaagatctaatggtacagcatgaaattcgtattcgtaat
ggaatgaaggcttatagtttattaaaacaattgcgtgaaggaaataccaatcctatcgta
cgtaaagcattcataaatagcaagcaagacttaggttatgggttgcttctgaaacgctat
acggacgatattactcaggctaatgagcaacaaatttgccaggcaactagggattctatt
ccacaagtagcaccactttatttctctttccgtattatggtaggttgtagtgtgattatg
ctaatgctaattgctttttgttttttggctgttattcgtaaccgtattggtcagccacgc
tggttacaatatgccatgctttatggaattccgttaccatggatagcaattgaatcgggt
tggtttattgctgaatatggccgtcagccttgggctattaatgaaattttgccaacttat
attgctcactcaactcttacaactcatgaaatacttttttcaatgggattaatttgtggg
ctatatacattatttttactagcagaaatatatctgatatttaaattcgctcgcttaggg
ccaagtagtctgaaaactggaaattactattttgagaaattatcttcttcaataagcgta
caataa

DBGET integrated database retrieval system