KEGG   Candidatus Gullanella endobia (Ferrisia virgata): FVIR_GE00521
Entry
FVIR_GE00521      CDS       T04502                                 

Gene name
pal
Definition
(GenBank) Peptidoglycan-associated lipoprotein precursor
  KO
K03640  peptidoglycan-associated lipoprotein
Organism
ged  Candidatus Gullanella endobia (Ferrisia virgata)
Brite
KEGG Orthology (KO) [BR:ged00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ged02000]
    FVIR_GE00521 (pal)
Transporters [BR:ged02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   FVIR_GE00521 (pal)
SSDB
Motif
Pfam: OmpA DUF3836
Other DBs
NCBI-ProteinID: CUX96356
UniProt: A0A143WRC9
Position
I:926867..927385
AA seq 172 aa
MKLNKIMKGLILTIPIVVITACSFYKNANNSNEAAIIDNTSNNINISSHSVHSDNQARLQ
IQDLHCNNIIYFNLNEHNIRSEFVHVLDIHANFLCNNPKNKVIIEGHTDALGTPEYNIAL
GERRANAVKMYLHNKGVSTDQIDVISYGKEKPAVLGHNKLAYAKNRRTVLIY
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaaactaaacaaaataatgaaaggactaatattaacgatacctatagtagtaattact
gcatgtagtttttataaaaacgctaataatagtaatgaagctgctattatcgataataca
agtaataatataaacatcagcagccacagtgttcattccgataatcaagctcgtcttcaa
atacaggatcttcattgcaataatattatctattttaatttgaatgaacataatattcga
tctgaattcgttcatgtacttgatatacatgctaatttcttatgcaataatccaaaaaat
aaagtgatcattgaaggacatacagatgcacttggtacaccagaatataatattgctcta
ggtgagcgtcgcgccaatgctgtaaaaatgtatcttcataataaaggtgtttctactgat
cagatcgatgtcatatcttatggtaaagagaaaccagctgtacttggccacaataaatta
gcttacgctaaaaatcgtcgtacagttcttatttactga

DBGET integrated database retrieval system